DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Glrb

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_445748.1 Gene:Glrb RGDID:2706 Length:496 Species:Rattus norvegicus

Alignment Length:454 Identity:84/455 (18%)
Similarity:144/455 (32%) Gaps:156/455 (34%)


  Fly   120 RNAMGMRRVATNQEPNLVS----LYDPTPIEIVQNQNGELFVYIPGFKKEPLLQFIDEAPLVINY 180
            ::|..:.||..|...|:::    .|||.              ..|.||..|:       .:|:| 
  Rat    43 QSAEDLARVPPNSTSNILNRLLVSYDPR--------------IRPNFKGIPV-------DVVVN- 85

  Fly   181 LSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQT 245
            :..:||||                                                         
  Rat    86 IFINSFGS--------------------------------------------------------- 93

  Fly   246 RSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDF-GSLESFEHPDLR--IWKPHMNVLNGALQSM 307
                .::|:...:..:.:...|.|.||. .|.|| ||......|.:.  :|||.:...|....:.
  Rat    94 ----IQETTMDYRVNIFLRQKWNDPRLK-LPSDFRGSDALTVDPTMYKCLWKPDLFFANEKSANF 153

  Fly   308 GQVLQ-SYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYD 371
            ..|.| :..|.::.:|.: |.:..|.:...|......:|.:...|.::|        |:.....|
  Rat   154 HDVTQENILLFIFRDGDV-LVSMRLSITLSCPLDLTLFPMDTQRCKMQL--------ESFGYTTD 209

  Fly   372 DQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQR---RYNPKGMMQKMTG---DVAIEFTLQRNR 430
            |.|        ....||.......:.|.:.|.::   .|.......|.||   .|.:.|||:|..
  Rat   210 DLR--------FIWQSGDPVQLEKIALPQFDIKKEDIEYGNCTKYYKGTGYYTCVEVIFTLRRQV 266

  Fly   431 SFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKV 495
            .|||...|.|                    :|:::.|   :|...::...||...||  :..:.|
  Rat   267 GFYMMGVYAP--------------------TLLIVVL---SWLSFWINPDASAARVP--LGIFSV 306

  Fly   496 IMMTTTYCYILHICIIWLDLYPPRSKAPGWLVRVINSNVLRCILGLRFSDSTDYCDIQ---ENP 556
            :.:.:.       |.......|..|     .|:.::..::.|:| ..|:...:|..:|   .||
  Rat   307 LSLASE-------CTTLAAELPKVS-----YVKALDVWLIACLL-FGFASLVEYAVVQVMLNNP 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 18/75 (24%)
Neur_chan_LBD 212..429 CDD:280998 42/227 (19%)
GlrbNP_445748.1 LIC 43..495 CDD:273305 84/455 (18%)
Neur_chan_LBD 59..266 CDD:280998 55/308 (18%)
Strychnine-binding. {ECO:0000250|UniProtKB:O93430} 247..253 3/6 (50%)
Neur_chan_memb 273..492 CDD:280999 21/124 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.