| Sequence 1: | NP_651958.2 | Gene: | NtR / 43935 | FlyBaseID: | FBgn0029147 | Length: | 585 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_058774.2 | Gene: | Chrna5 / 25102 | RGDID: | 2347 | Length: | 467 | Species: | Rattus norvegicus |
| Alignment Length: | 406 | Identity: | 70/406 - (17%) |
|---|---|---|---|
| Similarity: | 141/406 - (34%) | Gaps: | 128/406 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 251 EQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVL---NGALQSMGQVLQ 312
Fly 313 SYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPI 377
Fly 378 APNEHVNTPSGWSF--TQMSVVLVENDSQRR-YNPKGMMQKMT-----GD----------VAIEF 424
Fly 425 TLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSL-----ILIALLIAAWGLMYMTRYASPH 484
Fly 485 YVPPMMTAYKVI--------MMTTTYCYILH-------------ICIIWLDLYPP----RSKAPG 524
Fly 525 WL------------------------VRVINSNVLRCILGLRFSDSTDYCDIQENPWHHMAKILN 565
Fly 566 NLSSILVIITFAIVDI 581 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| NtR | NP_651958.2 | Methyltransf_FA | 90..191 | CDD:289052 | |
| Neur_chan_LBD | 212..429 | CDD:280998 | 33/198 (17%) | ||
| Chrna5 | NP_058774.2 | LIC | 41..448 | CDD:273305 | 70/406 (17%) |
| Neur_chan_LBD | 47..250 | CDD:280998 | 34/199 (17%) | ||
| Neur_chan_memb | 257..446 | CDD:280999 | 34/199 (17%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3645 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||