DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrna3

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_434692.2 Gene:Chrna3 RGDID:2345 Length:499 Species:Rattus norvegicus

Alignment Length:422 Identity:80/423 (19%)
Similarity:143/423 (34%) Gaps:94/423 (22%)


  Fly   199 FDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLA-YEQTSSLLQTRMH 262
            |:.|...|.|:.                  |.|.|.   .|.|......|. .::.:.:::|.:.
  Rat    37 FEDYNEIIRPVA------------------NVSHPV---IIQFEVSMSQLVKVDEVNQIMETNLW 80

  Fly   263 MMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLY 327
            :...|.|.:|.|||.|:..:|....|..:||||.:.:.|.| ....||....:.::...|.:|..
  Rat    81 LKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNA-DGDFQVDDKTKALLKYTGEVTWI 144

  Fly   328 AQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQR-KPIAPNEHVNTPSGWSF 391
            ...: ..|.|......:|.:...|.::.|          :..||..: ..:.....:|....|..
  Rat   145 PPAI-FKSSCKIDVTYFPFDYQNCTMKFG----------SWSYDKAKIDLVLIGSSMNLKDYWES 198

  Fly   392 TQMSVVLVEN-DSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLR 455
            .:.:::.... ..:.:||   ..:::..|:.....::|...||.....:|.:......:|.|.|.
  Rat   199 GEWAIIKAPGYKHEIKYN---CCEEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLP 260

  Fly   456 ST--RRSSLILIALLIAAWGLMYMTR-YASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLDLY- 516
            |.  .:.:|.:..||.....|:.:|. ..|...|.|::..|.:..|......|: |.:..|::: 
  Rat   261 SDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIV-ITVFVLNVHY 324

  Fly   517 --PPRSKAPGWLVRVINSNVL---------------------------------------RCILG 540
              |.....|.| |:.:..|:|                                       .|..|
  Rat   325 RTPTTHTMPTW-VKAVFLNLLPRVMFMTRPTSGEGDTPKTRTFYGAELSNLNCFSRADSKSCKEG 388

  Fly   541 LRFSDST-DYCDIQENPWHHMAKILNNLSSIL 571
            ....|.| .||       ||....::|.|:.|
  Rat   389 YPCQDGTCGYC-------HHRRVKISNFSANL 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 39/220 (18%)
Chrna3NP_434692.2 LIC 24..490 CDD:273305 80/423 (19%)
Neur_chan_LBD 29..235 CDD:280998 43/234 (18%)
Neur_chan_memb 242..489 CDD:280999 35/182 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.