DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrnb1

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_008765992.1 Gene:Chrnb1 RGDID:2349 Length:504 Species:Rattus norvegicus

Alignment Length:368 Identity:82/369 (22%)
Similarity:142/369 (38%) Gaps:45/369 (12%)


  Fly   203 GSEIAPIVKEETKTEKLLSHLNIQAENASMPA----NLSSISFHF---QTRSLAYE-QTSSLLQT 259
            |:.:||..:......:||..|....:::..||    :...:|...   |..||..| :....:.|
  Rat    14 GTPLAPGARGSEAEGQLLKKLFSDYDSSVRPAQEVGDRVGVSIGLTLAQLISLVRENEKDEEMST 78

  Fly   260 RMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSI 324
            ::::.:.|.|.||.|.|.:...:||.......:|.|.:.:||.. .....|.....::|...||:
  Rat    79 KVYLDLEWTDYRLSWDPAEHDGIESLRVTAESVWLPDVVLLNNN-DGNFDVALDINVVVSFEGSV 142

  Fly   325 T-----LYAQNLQLA------SW--C--VDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQR 374
            .     ||..:..:.      .|  |  |.|:.::.|..|:.......:|||.||    ||..:.
  Rat   143 RWQPPGLYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVSLKTGPDPDGQERQE----IYIHEG 203

  Fly   375 KPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYL 439
            ..|...:       |........|:.....||...:|..:    :|.....::|...||:.....
  Rat   204 TFIENGQ-------WEIIHKPSRLIHLPGDRRGGKEGHRE----EVIFYLIIRRKPLFYLVNVIA 257

  Fly   440 PLIACQMFLILSFVL--RSTRRSSLILIALL-IAAWGLMYMTRYASPHYVPPMMTAYKVI-MMTT 500
            |.|...:..|..|.|  .:..:..|.:.||| :..:.|:...:........|::..|.:. |:..
  Rat   258 PCILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPETSLAVPIIIKYLMFTMILV 322

  Fly   501 TYCYILHICIIWLDLYPPRS-KAPGWLVRVINSNVLRCILGLR 542
            |:..||.:.::.|....|.: :.|.| ||.|..:.|...|||:
  Rat   323 TFSVILSVVVLNLHHRSPHTHQMPFW-VRQIFIHKLPPYLGLK 364

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 50/240 (21%)
Chrnb1XP_008765992.1 LIC 24..491 CDD:273305 79/359 (22%)
Neur_chan_LBD 27..248 CDD:280998 50/237 (21%)
Neur_chan_memb 255..490 CDD:280999 27/112 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.