DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and pbo-6

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001294833.1 Gene:pbo-6 WormBaseID:WBGene00017375 Length:422 Species:Caenorhabditis elegans

Alignment Length:393 Identity:76/394 (19%)
Similarity:150/394 (38%) Gaps:70/394 (18%)


  Fly   216 TEKLLSHLNIQAENASMPANLSSISFHFQ-TRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDF 279
            :.:|..||..:....|.|.....||.:.: ...:...:.:..:|..::::..|.|:.|.||.|:|
 Worm    30 SSRLTRHLLEKHNKCSPPDGRVDISHNIELVHIIGINELNQNMQVLVYIVQQWTDASLSWKVEEF 94

  Fly   280 GSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYE--LMVYANGSITLYAQNLQLASWCVDSAR 342
            ..::....|:..||.|.:.|.|.....|  :|::..  :.|...|.:| ||........|.....
 Worm    95 RGIKHTWLPEHSIWIPDIIVFNTLEHKM--LLEAVRSPIKVSYTGEVT-YAYPAIYTVLCQIGIA 156

  Fly   343 NWPSERVTCDIELGLNGQEGQENVALIYDDQR-------KPI----APNEHVNTPSGWSFTQMSV 396
            .:|.:...|.|..          .:..||:.:       ||:    :|||.      |:...:.:
 Worm   157 TFPFDDQVCKIRF----------ASWAYDEDKILLNASHKPLLKNYSPNEE------WALQDVDM 205

  Fly   397 VLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLP-LIACQMFLILSFVLRSTR-- 458
            ...|.:.:         :.:..::.....:.|...:|:....:| .|.|.:.:...|...||:  
 Worm   206 ARKEYEHE---------ETVVSEIIYYIKVARKPFYYLISLVVPSYIICVLSIAGLFARFSTKHE 261

  Fly   459 ---RSSLILIALLIAAWGLMYMTRYASPH---YVPPMMTAYKVIMMTTTYCYILHICIIWLDLYP 517
               |.:|.:.|:|..|...:.:|... ||   .||.::.....|::..|...||...::.:....
 Worm   262 RQERFTLGVTAILSMAVLSLVVTEKV-PHSSENVPLLIVYMHFIIVMVTIATILTSTVMRVHAKG 325

  Fly   518 PRS---KAPGWLVRVI-----NSNVLRCILGLRFSDSTDYCDIQ--ENPWHHMAKILNN-LSSIL 571
            .|:   ..|.|:.:|:     ::|..:       .....|.||.  ...|..:::.::. |:|:.
 Worm   326 FRTHFLSPPNWIRKVLLIARKHANFFQ-------QHGKVYMDIHTTAEQWGEVSRRMDYLLASVF 383

  Fly   572 VII 574
            :||
 Worm   384 III 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 42/227 (19%)
pbo-6NP_001294833.1 Neur_chan_LBD 31..230 CDD:280998 42/227 (19%)
Neur_chan_memb 264..>342 CDD:280999 18/79 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.