DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and HTR3D

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001157118.1 Gene:HTR3D HGNCID:24004 Length:454 Species:Homo sapiens

Alignment Length:418 Identity:81/419 (19%)
Similarity:146/419 (35%) Gaps:111/419 (26%)


  Fly   160 PGFKKEPLLQFIDEA--------PLVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKT 216
            ||   .|.|..:.::        .|:||...|.....:.|.  :...||  ...|.|:......|
Human     6 PG---PPALALLSQSLLTTGNGDTLIINCPGFGQHRVDPAA--FQAVFD--RKAIGPVTNYSVAT 63

  Fly   217 EKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGS 281
                 |:|              |||   |.|..:...|.:.....|....|.:..:.|.|::.|.
Human    64 -----HVN--------------ISF---TLSAIWNCYSRIHTFNCHHARPWHNQFVQWNPDECGG 106

  Fly   282 LESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASW------CVDS 340
            ::........:|...:.:.....|:...::.|..::...:.:|:....:.. |:|      .:|.
Human   107 IKKSGMATENLWLSDVFIEESVDQTPAGLMASMSIVKATSNTISQCGWSAS-ANWTPSISPSMDR 170

  Fly   341 ARNWPSERVTCDIE---------------LGLNGQEGQENVALIYDDQ-------RKPIAPNEHV 383
            ||.|  .|::...:               ||:..:..:..||....:|       |:...|:.:|
Human   171 ARAW--RRMSRSFQIHHRTSFRTRREWVLLGIQKRTIKVTVATNQYEQAIFHVAIRRRCRPSPYV 233

  Fly   384 ---NTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQ 445
               ..|||        :|:..|:...|.|     ..:|:.|         .|.|||    |:...
Human   234 VNFLVPSG--------ILIAIDALSFYLP-----LESGNCA---------PFKMTV----LLGYS 272

  Fly   446 MFLI-LSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTTTYCYILHIC 509
            :||: ::.:|.:|..||   .|.|:|...||.....|..::...:......::.|....::||:.
Human   273 VFLLMMNDLLPATSTSS---HASLVAPLALMQTPLPAGVYFALCLSLMVGSLLETIFITHLLHVA 334

  Fly   510 IIWLDLYPPRSKAPGWLVRVINSNVLRC 537
                      :..|..|.|.::|.:|.|
Human   335 ----------TTQPLPLPRWLHSLLLHC 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 8/39 (21%)
Neur_chan_LBD 212..429 CDD:280998 42/248 (17%)
HTR3DNP_001157118.1 Neur_chan_LBD 55..>130 CDD:280998 16/97 (16%)
LIC 92..452 CDD:273305 58/304 (19%)
Neur_chan_memb 237..>351 CDD:280999 34/153 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.