DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and glra4b

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001189440.1 Gene:glra4b ZFINID:ZDB-GENE-020402-2 Length:492 Species:Danio rerio

Alignment Length:322 Identity:71/323 (22%)
Similarity:117/323 (36%) Gaps:101/323 (31%)


  Fly   201 GYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMM 265
            ||.:.|.|               |.:....::..|:...||...|      :|:...:..:.:..
Zfish    56 GYDARIRP---------------NFKGPPVNVTCNIFINSFGSIT------ETTMDYRLNVFLRQ 99

  Fly   266 HWRDSRLVWK--PEDFGSLESFEHPDL--RIWKPHMNVLNGALQSMGQVLQSYELM-VYANGSIT 325
            .|.|.||.:|  |:|...|:    |.:  .||||.:...|....:..:|....:|: ::.||:: 
Zfish   100 QWNDPRLAYKEYPDDSLDLD----PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFQNGNV- 159

  Fly   326 LYAQNLQLASWCVDSARNWPSERVTCDIELGLNG-----------QEGQENVALIYDDQRKPIAP 379
            ||:..|.|...|....:|:|.:..||.::|...|           .||...||   ||...|   
Zfish   160 LYSIRLTLILSCPMDLKNFPMDTQTCTMQLESFGYTMNDLIFQWLDEGPVQVA---DDLMLP--- 218

  Fly   380 NEHVNTPSGWSFTQMSVVLVEND---SQRRYNPKGMMQKMTGD---VAIEFTLQRNRSFYMTVFY 438
                          ..|:..|.|   ..:.||        ||.   :.::|.|:|...:|:...|
Zfish   219 --------------QFVLKEEKDLGYCTKHYN--------TGKFTCIEVKFHLERQMGYYLIQMY 261

  Fly   439 LPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTT 500
            :|                    ||:.:   |.:|...::...|:|..|...:|.  |:.|||
Zfish   262 IP--------------------SLLTV---ILSWVSFWINMDAAPARVGLGITT--VLTMTT 298

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 52/239 (22%)
glra4bNP_001189440.1 LIC 5..478 CDD:273305 71/323 (22%)
Neur_chan_LBD 47..253 CDD:280998 56/251 (22%)
Neur_chan_memb 260..475 CDD:280999 14/65 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.