DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and ggr-3

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_494951.3 Gene:ggr-3 WormBaseID:WBGene00001588 Length:445 Species:Caenorhabditis elegans

Alignment Length:266 Identity:58/267 (22%)
Similarity:101/267 (38%) Gaps:61/267 (23%)


  Fly   210 VKEETKTEKL----------------LSHLNIQAENASMPANLS---SISFHFQTRSLAYEQTSS 255
            |.:|.|||.|                |:.|....:...:|:|.|   |:....|..|...|.:||
 Worm    14 VAKEVKTESLVDPAHCEYNSNHRKSILTDLLQDYDKTMVPSNNSVQVSVELTVQDISSISEISSS 78

  Fly   256 LLQTRMHMMMHWRDSRLVWKP---EDFGSLESFEHPDLRIWKPHMNVLNG-ALQSMGQVLQSYEL 316
            .: ..:.....|.|.||.::.   :...||:|:...  |:|.|::..:|. :.|.......:..|
 Worm    79 FI-ADVWFSQVWYDPRLEYRNISCKTNLSLDSYVSE--RLWTPNVCFVNSKSTQVHKSPASNILL 140

  Fly   317 MVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDI----------ELGLNGQEGQENVALIYD 371
            ::|.||::.| ...:|:::.|......:|.:...|.:          |:.||.|           
 Worm   141 IIYPNGTVWL-NYRVQVSAPCSFELSRFPIDAQECHLVFESYSYNIAEVRLNWQ----------- 193

  Fly   372 DQRKPIA--PNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYM 434
             |..|:.  |.|....|. :.|..::.....|:    |. .||..::    .:.|..:|...:|:
 Worm   194 -QWAPVTMPPPEDFRLPD-FQFYNVTWGKTSNE----YT-AGMWDQL----KVTFRFKRLYGYYV 247

  Fly   435 TVFYLP 440
            ...|||
 Worm   248 LQMYLP 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 53/252 (21%)
ggr-3NP_494951.3 LIC 39..439 CDD:273305 52/242 (21%)
Neur_chan_LBD 39..243 CDD:280998 48/230 (21%)
Neur_chan_memb 250..436 CDD:280999 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.