DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and ggr-2

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001024472.2 Gene:ggr-2 WormBaseID:WBGene00001587 Length:546 Species:Caenorhabditis elegans

Alignment Length:437 Identity:80/438 (18%)
Similarity:149/438 (34%) Gaps:139/438 (32%)


  Fly   163 KKEPLLQFIDEAPLVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIV--KEETKTEKLLSHLNI 225
            :.||:..::|      |.|       |..|..||       ::..|:.  |||....:|..::. 
 Worm    22 RSEPVPIYLD------NLL-------NAGRQVYD-------NQSPPVQHDKEEVTVVELAMYIE- 65

  Fly   226 QAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDL 290
                     .:||    |:|:::.:       |..::....|||.||.             |.:.
 Worm    66 ---------GMSS----FRTQTMDF-------QLDVYFQQFWRDPRLA-------------HNET 97

  Fly   291 R------------IWKPHMNVLNGALQSMGQVLQ-SYELMVYANGSITLYAQNLQLASWCVDSAR 342
            |            :|||.:...|..:....:|.| ::.:.:..:||| ||...:.:...|..:..
 Worm    98 RRVLVKDKAVLHKMWKPDVYFANARIAEFHEVTQPNFLVWIQPDGSI-LYDTRISMVVVCTLNLE 161

  Fly   343 NWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVV-LVENDSQRR 406
            .||.:...|.:.: |:.....|.:.:.:.:. :||..|.::      :.:.|.:| |........
 Worm   162 KWPLDSQRCHLRI-LSYAYTTEQLVIKWKED-EPITRNPNI------AMSDMHIVDLYPGLCDGN 218

  Fly   407 YNPKGMMQKMTGD---VAIEFTLQRNRSFYMTVFYLP---LIACQMFLILSFVLRSTRRSSLILI 465
            |:        ||.   |..||.::|..:.::...|:|   ::....|.....|.....|.||.:.
 Worm   219 YS--------TGTWSCVTAEFFVKREITHHVMQSYVPTTLIVVISWFSFWLDVEAVPARVSLAIT 275

  Fly   466 ALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTTTYC--YILHICIIWLDLYPPRSKAPGWLVR 528
            .||..:      |:..:.....|.::..|.|.:....|  ::..:.|.:               .
 Worm   276 TLLTLS------TQANAARMALPEVSYMKAIDVWMGACMMFVFGVMIEF---------------T 319

  Fly   529 VINSNVLRCILGLRFSDSTDYCDIQENPWHH------MAKILNNLSS 569
            ::|                 |...|...||.      ||..|.::.|
 Worm   320 IVN-----------------YAQRQGRKWHRTDAEIVMASSLESVKS 349

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 6/28 (21%)
Neur_chan_LBD 212..429 CDD:280998 45/234 (19%)
ggr-2NP_001024472.2 LIC 30..541 CDD:273305 78/430 (18%)
Neur_chan_LBD 41..237 CDD:280998 49/254 (19%)
Neur_chan_memb 245..538 CDD:280999 24/144 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.