DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and ggr-1

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_496306.2 Gene:ggr-1 WormBaseID:WBGene00001586 Length:473 Species:Caenorhabditis elegans

Alignment Length:364 Identity:69/365 (19%)
Similarity:127/365 (35%) Gaps:84/365 (23%)


  Fly   177 VINYLSFSSFGSNTARWFYDCGFD----------GYGSEIAPIVKEETKTEKLLSHLNIQAENAS 231
            |:....|..:..|..:...|...|          .|.....|::.::     |.:|::||.....
 Worm    17 VLGQAEFWDYDENVTQIEEDFKIDDVTRILKRVGNYNRNAYPLLDQD-----LATHVDIQMYIEG 76

  Fly   232 MPANLSSISFHFQTRSLAYEQTSSLLQTRM--HMMMHWRDSRLVWK-PEDFGSLESFEHPDLRIW 293
            |.      |||.|:...   |.....|.:.  |.:.|....|::.| |:.||.|          |
 Worm    77 MS------SFHAQSMDF---QVDIYFQEKWVDHRLQHNNTKRILVKDPKLFGLL----------W 122

  Fly   294 KPHMNVLNGALQSMGQVLQ-SYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGL 357
            .|.:...|....|...|.| ::.:.:|.||:: .|...:.|...|:.....:|.:...|.:.:  
 Worm   123 HPDLYFANARTASFHDVTQPNFLVWIYPNGTV-WYDCRISLTVLCMQDLARYPLDSQNCGLRI-- 184

  Fly   358 NGQEGQENVALIYDDQR--------KPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQ 414
                    ::..||:::        .|:..|..:..|      .|.:..::..::|.....|:. 
 Worm   185 --------LSYAYDEEQLIIRWNGGNPVEVNRGIRMP------DMHLKHIKFYTKRDKYATGIW- 234

  Fly   415 KMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSF------VLRSTRRSSLILIALLIAAWG 473
               .....||.:.|..:.::...|:|   ..:.:|:|:      |.....|.||.:..||..|  
 Worm   235 ---SSAVAEFHVDREITHHIIQSYIP---TSLIVIISWFSFWLDVEAVPGRVSLSITTLLTLA-- 291

  Fly   474 LMYMTRYASPHYVPPMMTAYKVI--MMTTTYCYILHICI 510
                |:.::.....|..:..|.|  .|.|...::....|
 Worm   292 ----TQSSAARMALPQASDVKAIDVWMGTCMAFVFSAMI 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 3/14 (21%)
Neur_chan_LBD 212..429 CDD:280998 44/229 (19%)
ggr-1NP_496306.2 Neur_chan_LBD 43..217 CDD:280998 41/215 (19%)
LIC 44..460 CDD:273305 64/338 (19%)
Neur_chan_memb 255..457 CDD:280999 18/82 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.