DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and acr-18

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_506868.2 Gene:acr-18 WormBaseID:WBGene00000057 Length:510 Species:Caenorhabditis elegans

Alignment Length:352 Identity:76/353 (22%)
Similarity:126/353 (36%) Gaps:101/353 (29%)


  Fly   192 RWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSL 256
            |..|:..|..|..||.| |:.|:::.|:                  .|.|..: :.|..::...:
 Worm    31 RNLYEHLFLDYVKEIRP-VRNESESLKV------------------EIKFWLK-QILKVDERDQI 75

  Fly   257 LQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYAN 321
            :.....:.::|.|..|.|.|:.||:|.....|..:||||.:.|.|.|..::.:.......:|...
 Worm    76 VNIYCWLELYWIDETLTWDPKKFGNLSRIHVPAHKIWKPDVLVYNNANMNVEENEMETNAIVDNT 140

  Fly   322 GSITLYAQ---------NLQ------------LASWCVDSARNWPSERVTCDIELGLNGQEGQEN 365
            |.:.|:..         |||            .|||.:|.::            |.|:.....:|
 Worm   141 GRVMLFRSMITDISCNLNLQQFPFDQQICFVTFASWSMDGSK------------LDLSATPKTDN 193

  Fly   366 VALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYN------PKGMMQKMTGDVAIEF 424
            :.|...            ||.  |..|...|.:.    |:.|:      |         ||....
 Worm   194 LELYIR------------NTE--WGLTDFRVKIY----QKIYDCCPHPFP---------DVTYFM 231

  Fly   425 TLQRNRSFYMTVFYLPLIACQMFLILSFVL------RSTRRSSLILIALL-IAAWGLMYMTRYAS 482
            .|:|:.|:|:....:|.....:..|:.|..      .:|.:.||.:.||| :|...:|......:
 Worm   232 VLRRSPSYYIFSLVIPSAFITVVTIVGFFTPHSTTGENTEKVSLGVTALLSMAIIMMMVSDEVPA 296

  Fly   483 PHYVPPMMTAYKV-----IMM---TTT 501
            ...|.|::..|.:     |.|   |||
 Worm   297 TSEVIPLIGKYYIGLIFLIFMAAFTTT 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 47/244 (19%)
acr-18NP_506868.2 Neur_chan_LBD 33..237 CDD:280998 54/263 (21%)
Neur_chan_memb 244..486 CDD:280999 19/81 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.