DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and acr-17

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001023961.1 Gene:acr-17 WormBaseID:WBGene00000056 Length:515 Species:Caenorhabditis elegans

Alignment Length:401 Identity:85/402 (21%)
Similarity:160/402 (40%) Gaps:81/402 (20%)


  Fly   199 FDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHM 263
            |..|..|:.| ||:|                :|.|.|: ::..:|:.....:| ...::.....:
 Worm    32 FRDYHKELRP-VKDE----------------SSGPTNV-TVQLYFKQIQKVHE-NDQIITLYCWI 77

  Fly   264 MMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYA 328
            ..:|:|..|.|.|.|||:::|...|...||||.:.|.|.|..::.:......:.:...|.|:|:.
 Worm    78 EEYWQDEFLTWNPSDFGNIKSLHVPSEMIWKPDLLVYNNANMNIKENEMQTNVQIEHTGKISLFR 142

  Fly   329 Q-------NLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPI-APNEHVNT 385
            .       :||:        ..:|.::..|.|.|.....:|.:   ::.:...:|. ||.:..||
 Worm   143 AIITDITCDLQM--------EKFPYDQQICFIMLASWSYDGSQ---IMLNTAEQPTEAPLDIKNT 196

  Fly   386 PSGWSFTQMSVV--LVEN------DSQRRYNPK--GMMQKMTGDVAIEFTLQRNRSFYMTVFYLP 440
                  |.::::  .:.|      |.:.|.|.|  ........|::..|.::||.|:|:....:|
 Worm   197 ------TNLAILNHYIPNMEWKLVDFRYRNNLKYYDCCPNPYPDISYFFAIKRNPSYYLFTLIIP 255

  Fly   441 LIACQMFLILSFVL------RSTRRSSLILIALLIAAWGLMYMT-RYASPHYVPPMMTAYKV--- 495
            .....:..::.|..      .:|.:.||.:.|||..|..||.:: :..:.....|::..|.:   
 Worm   256 SAFITIVTVIGFFTPHSSTGENTEKVSLGVTALLSLAIILMMVSDKLPATSNSVPLLGQYYIGLI 320

  Fly   496 -IMMTTTYCYILHICIIWLDLYPPRSKAPGWLVRVINSNVLRCILGLRFSDSTDYCDIQENPWHH 559
             ||...|||....:.|          :..|...|.|...:...:|.:|.:.::   .:|   |..
 Worm   321 FIMFLATYCTTFTLGI----------QMQGNAGRPITRRLRSFLLSIRMNRNS---FVQ---WFF 369

  Fly   560 MAKILNNLSSI 570
            ..:::|...||
 Worm   370 GRELMNTQESI 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 47/235 (20%)
acr-17NP_001023961.1 LIC 23..491 CDD:273305 85/402 (21%)
Neur_chan_LBD 24..245 CDD:280998 54/249 (22%)
Neur_chan_memb 252..491 CDD:280999 29/146 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.