DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and acr-5

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_498437.2 Gene:acr-5 WormBaseID:WBGene00000044 Length:598 Species:Caenorhabditis elegans

Alignment Length:488 Identity:92/489 (19%)
Similarity:157/489 (32%) Gaps:169/489 (35%)


  Fly   229 NASMPA-NLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRI 292
            |.||.. .:..:..|.|:           ::..:.|:.||.|..|.|.|.|:|.:.....|..:|
 Worm   134 NLSMSLYQILDVDEHMQS-----------IEVNVWMVQHWYDEFLDWNPVDYGMINRTIVPYHQI 187

  Fly   293 WKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASW--------------------C 337
            |.|...:.|           |.||......|: :.|| |:...|                    |
 Worm   188 WIPDTYLYN-----------SEELEQKKTESL-MNAQ-LETGHWNQKKDGAKVQLMFPAIYKLSC 239

  Fly   338 VDSARNWPSER---------------------VTCDIELGLNGQEGQENV--------------- 366
            ....|.:|.:|                     ::..:.||...:..:..|               
 Worm   240 RMDVRWFPYDRQNYKTSFKPMKLLQQTIDYWPLSSTVNLGNMARNDEWEVISFEFVRVEETFKCC 304

  Fly   367 ----ALIYDD---QRKP-------IAPNEHVN--------TPSGWS-------------FTQMSV 396
                .::|..   :|||       :.|...:.        ||:..|             ...|||
 Worm   305 TAPWVMLYAHLVIRRKPLYYMINLVVPTSIITIVAVTGFFTPTSSSSERDEKLYLGINTLLTMSV 369

  Fly   397 VLV----ENDSQRRYNPK------GMMQKM-------TGDVAIEFTLQRNRSF---YMTVFYLPL 441
            :::    :..|...|.|.      |::..:       ||.:||......|:..   ...:.|.|:
 Worm   370 MMLMVCNQMPSTSTYVPLMSWYYIGIIMVIVVGTFLATGVLAIHGQKHYNKPISDRIRKLIYNPV 434

  Fly   442 IACQMFLILS-----------FVLRSTRRSSLILIALLIAAWGLMYMTRYASP-HYVPPMMTAYK 494
            :.   |.|||           |.:.|.:|.|..|..||:.....:..|..|.| |:...:.:  :
 Worm   435 VE---FFILSPPTSLIDLWTEFGVISEQRHSTHLDPLLLQHMDPISHTTRADPQHFFGSISS--Q 494

  Fly   495 VIMMTTTYCYILHICIIWLDLYPPRSKAPGWLVRVINSNVLRCIL------GLRFSDSTDYCDIQ 553
            :..:.:||.|...:..|... |...:|     ::.:..|..|..:      |::.......|.::
 Worm   495 MCDLQSTYSYTARLATITRQ-YTQHAK-----MKALRKNQYRMSMDTSQARGVKKQKMQRRCSLE 553

  Fly   554 ENPWHHMAKILNN-LSSILVIITFAIVDITSGF 585
               |..:|.:|:. |.:|....|||:..|..||
 Worm   554 ---WEFLANVLDRILLTIFCGFTFAVFIILIGF 583

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 53/309 (17%)
acr-5NP_498437.2 LIC 104..581 CDD:273305 90/485 (19%)
Neur_chan_LBD 104..321 CDD:280998 37/211 (18%)
Neur_chan_memb 328..581 CDD:280999 52/267 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.