DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and acr-6

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_491354.2 Gene:acr-6 WormBaseID:WBGene00000045 Length:551 Species:Caenorhabditis elegans

Alignment Length:427 Identity:85/428 (20%)
Similarity:148/428 (35%) Gaps:104/428 (24%)


  Fly   197 CGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLA----YEQTSSLL 257
            |.|..|.|..          |.||:..|..|..:....|..:|.|..:...:.    .:|..:|.
 Worm    15 CSFTAYKSLF----------ETLLARYNKIAFPSGEFNNTLTIEFKLRLDQIVDVHEKDQVITLK 69

  Fly   258 QTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGA-----LQSMGQVLQSYELM 317
            .|.:|   ||.|.||.|.|::||::.....|...:|.|.:.:.|.|     :....||..|:|..
 Worm    70 GTLIH---HWLDYRLSWNPDEFGNITLMHFPGEMLWLPDIILYNNAHGSPWVSETTQVHVSFEGR 131

  Fly   318 V----------YANGSITLYAQNLQL-----ASW------------CVDSARNWPSERVTCD--- 352
            |          :.|..|..|..:||:     .||            ..|.|..  |...|.|   
 Worm   132 VTWQPPVVYDAFCNIDIEWYPYDLQICELKFGSWTYGGSQLNLIHLTTDQANE--STDATGDNVW 194

  Fly   353 -IELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKM 416
             :|.|::....||:|                          :..::.||....:::.|  .....
 Worm   195 KVERGVDLSNYQESV--------------------------EWDLLSVEGIRHKKWYP--CCDYP 231

  Fly   417 TGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVL--RSTRRSSL---ILIALLIAAWGLMY 476
            :.|:.....::|.:.||.....:|.:......:..|.|  .|.::..|   :|:||.:  :.||.
 Worm   232 SIDITYYLHIRRKKLFYTVNMIIPCVCLASMTLWVFYLPCESHQKIQLCISVLVALTL--YFLML 294

  Fly   477 MTRYASPHYVPPMMTAY----KVIMMTTTYCYILHICIIWLDLYPPRSK-APGWLVRVINSNVLR 536
            :........|.|::..|    .:::..:..|.:....|.:...|.|..: ...|.:..:...:| 
 Worm   295 IDIIPPTSIVTPLILKYLSFTMIMVALSVTCTVFIQNIHYRAYYQPMPRFVKHWFIEKLGKKLL- 358

  Fly   537 CILGLRFSDSTDYCDIQENPWHHMAKILNNLSSILVI 573
                  .|..|:.........|  .|.:|.||::.::
 Worm   359 ------ISRKTEQAQYHRTAQH--VKQVNALSAMNIL 387

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 53/257 (21%)
acr-6NP_491354.2 Neur_chan_LBD 23..244 CDD:280998 53/264 (20%)
Neur_chan_memb 252..524 CDD:280999 26/148 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.