DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-19

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_502905.2 Gene:lgc-19 WormBaseID:WBGene00013655 Length:400 Species:Caenorhabditis elegans

Alignment Length:349 Identity:67/350 (19%)
Similarity:120/350 (34%) Gaps:80/350 (23%)


  Fly   155 LFVYIPGFKKEPLLQFIDEAPLVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKL 219
            :|:.|..|       |.|....|..|..|.....|..:..    |..|...::|:.   |..:  
 Worm     9 IFMPIDSF-------FFDPELYVPKYKDFLDVQRNLTKHI----FRDYDPTVSPVY---TWVD-- 57

  Fly   220 LSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLES 284
             ..|.|..:|.: |...:...|.:..:.:..::....:...|.:|.:|.|:||.|....:.:...
 Worm    58 -VDLPIGYDNEA-PKRYNYTIFLYYLKLVEVQEPQEKISVVMEIMEYWYDARLSWNASAWQNTTM 120

  Fly   285 FEHPDLRIWKPHMNVLNG--------------ALQSMGQVLQSYELMVYANGSITLYAQNLQLAS 335
            ......::|.|.::|...              .:::.|.:.....:.|.||              
 Worm   121 IYMKQDKVWSPTISVFGVNDIVDFRDNDNRLICIENTGFIWDYVSVRVSAN-------------- 171

  Fly   336 WCVDSARNWPSERVTCDIE--LGLNGQEGQENVALIYD---DQR--KPIAPNEHVNTPSGW---S 390
             |......:|.:...|.|.  |.:..:...:.:..||:   |:|  |.:..:|       |   :
 Worm   172 -CEMDVSRFPFDTQICQIRFCLPIFYRVQVDILNEIYEEIMDERIFKTMGNSE-------WKLLN 228

  Fly   391 FTQMSVVLVENDSQRRYNPKGMMQKMTGDVAI-EFTLQRNRSFYMTVFYLPLIACQMFLILSFVL 454
            .|.....||.||:.      |.|     |:|| |.|::||..:|:.:...|........|:...|
 Worm   229 LTNRVEALVYNDNM------GTM-----DLAIFEITIRRNPLYYIYMIVFPSFIINFVSIVGVFL 282

  Fly   455 RSTRRSSLILIALLIAAWGLMYMT 478
            ....:.|.:.:.|.    .:|.||
 Worm   283 NGADKMSRLNVGLT----NIMTMT 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 9/36 (25%)
Neur_chan_LBD 212..429 CDD:280998 45/242 (19%)
lgc-19NP_502905.2 Neur_chan_LBD 34..258 CDD:280998 50/268 (19%)
Neur_chan_memb 265..>339 CDD:280999 8/43 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.