DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and acr-24

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001255865.1 Gene:acr-24 WormBaseID:WBGene00013534 Length:578 Species:Caenorhabditis elegans

Alignment Length:392 Identity:75/393 (19%)
Similarity:133/393 (34%) Gaps:82/393 (21%)


  Fly   186 FGSNTARWFYDCGFDGYGSEIAP---IVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRS 247
            ||:..|.      .|.|| |..|   :.|:.|...:..|.:. ...|.|.|..:|.....:|..|
 Worm    16 FGAREAL------MDDYG-EFLPHIRLAKDLTDPRRYDSRVR-PVMNHSKPTTVSFSMSLYQILS 72

  Fly   248 LAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQ 312
            :..:|.:  :...:..:..|.|..|.|.|..:|.:.:...|...||.|...:.|..:.:..:..:
 Worm    73 INEKQQN--VDLNVWAIQKWNDDFLGWNPYLYGMINTTILPFDAIWLPDTYLYNSVVMNREETER 135

  Fly   313 SYELMVYAN------GSITLYAQNLQLASWCVDSARNWPSERVTCDIELG--------LNGQEGQ 363
            ...::|..|      |:...:.......:.|:...|.:|.::..|.:.:.        :|.:...
 Worm   136 YINVVVTTNYWKGETGAEVKFMYPALYRTSCLLDIRFFPYDQQACKLTISSWTSSKSDINYEPEH 200

  Fly   364 ENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQR 428
            |:|.:  |:    ..|||.      |.....::..||........|..:::.:       ..::|
 Worm   201 ESVNM--DN----FLPNEE------WVVVSFNIKRVEEKFVCCPEPWVLLEAV-------LVVRR 246

  Fly   429 NRSFYMTVFYLPLIACQMFLILSFV----LRSTRRSSLIL-IALLIAAWGLMYMTRYASP---HY 485
            ...:|:....:|.....:..:..|.    ..|.||..|.| |..|:|...||.|.....|   .:
 Worm   247 KPLYYIVNLVIPTSVITLVAVTGFFTAASTSSERREKLSLGIDSLLAMSILMMMVSEQMPTSSDF 311

  Fly   486 VP----------------PMMTAY-----------KVIMMTTTYCYILHICIIWLDLYPPRSKAP 523
            ||                .:.||:           |.:....:|.:...|. .||.:.||.....
 Worm   312 VPLFGIFYLSIIFIIFIGTLFTAFILNVHLQKMYAKPVSPIVSYIFFGRIA-QWLRMRPPTMLLE 375

  Fly   524 GW 525
            .|
 Worm   376 LW 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 2/5 (40%)
Neur_chan_LBD 212..429 CDD:280998 39/231 (17%)
acr-24NP_001255865.1 Neur_chan_LBD 34..248 CDD:280998 40/236 (17%)
Neur_chan_memb 255..>411 CDD:280999 26/125 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.