DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-7

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_502777.2 Gene:lgc-7 WormBaseID:WBGene00013300 Length:439 Species:Caenorhabditis elegans

Alignment Length:409 Identity:85/410 (21%)
Similarity:143/410 (35%) Gaps:111/410 (27%)


  Fly   187 GSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYE 251
            |...|....|...:||.|.|.|:..|.          :|...|.||  |..|:        |..:
 Worm    24 GITVAEQLKDVLMEGYDSSIRPVNNER----------DILIINISM--NTMSV--------LTLD 68

  Fly   252 QTSSLLQTRMHMMMHWRDSRLVWKPEDFGSL-----ESFEHPDLRIWKPHMNVLNGALQSMGQVL 311
            .....:......::.|:|..|.|...|:...     |||      :|.|...|....  ....::
 Worm    69 PAEETINFSSEFILQWKDEFLFWNKSDYNITWLKLKESF------LWTPDTTVSTSI--DTNYLI 125

  Fly   312 QSYE--LMVYANGSI--TLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDD 372
            .:.|  :.|..:|::  ::||....|....||   .:|.::.||.|::|......||...::..|
 Worm   126 DASERYVSVKHDGTVRQSIYAVFTNLCDMNVD---KFPYDQQTCMIKMGPWSYTTQEVTCIVGRD 187

  Fly   373 QRKPIAPNE------HVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKM--TGDVAIEF----- 424
                ||||:      |.|  |.|.|                  :|::..:  |.|..:.|     
 Worm   188 ----IAPNDTDFGDFHGN--SEWDF------------------EGIVSSVGETEDPDVNFTFSEV 228

  Fly   425 ----TLQRNRSFYMTVFYLP----LIACQMFLILSFVLRSTRRSSLIL-IALLIAAWGLMYMTRY 480
                |::|...||:.|..:|    .:.|...|.........|...:.| |..|:::..::.:...
 Worm   229 HFALTVKRRPQFYVWVLLIPTYIITVVCIFGLFTPTANHGLREERVNLGITTLLSSAVILQIVAN 293

  Fly   481 ASPH---------------YVPPMMTAYKVIMMTTTYCYILHICIIWLDLYPPRSKAPGWLVRVI 530
            |.|.               :|..:...:.|:::|      ||......:..||....  |::|:.
 Worm   294 AMPKTSELPLLGNFILAEIFVVAIGVLFAVLVLT------LHQRAHTREWRPPAWML--WILRMT 350

  Fly   531 NSN--VLRCILGLRFSDST 547
            .|:  :.|.|..:|...||
 Worm   351 GSSKFLSRNITKIRHKSST 369

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 1/4 (25%)
Neur_chan_LBD 212..429 CDD:280998 50/243 (21%)
lgc-7NP_502777.2 LIC 6..437 CDD:273305 85/410 (21%)
Neur_chan_LBD 28..238 CDD:280998 57/265 (22%)
Neur_chan_memb 245..>349 CDD:280999 18/112 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.