DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and pbo-5

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001024240.1 Gene:pbo-5 WormBaseID:WBGene00012857 Length:509 Species:Caenorhabditis elegans

Alignment Length:372 Identity:86/373 (23%)
Similarity:148/373 (40%) Gaps:76/373 (20%)


  Fly   172 DEAP-LVINYLSFSSFGSNTARWFYDCGFDGYGSEIAP-IVKEETK--TEKLLSHLNIQAENASM 232
            :||| :::|:|:..|.|....:.          ::..| .|...:|  ||.|||..|:.|.    
 Worm    33 EEAPNVLLNHLNNESEGEELTQI----------NDTQPAFVPGSSKRLTEYLLSRHNLNAP---- 83

  Fly   233 PANLSSISFHFQ-TRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPH 296
            |..|..:.:..: ...|..::....:...:::..||.|..|.|.|..||.:.....|..:||.|.
 Worm    84 PDGLLYVEYELELVHILGIDELKQTMTVLIYVDEHWVDPSLTWDPALFGGITKTWIPLDKIWVPD 148

  Fly   297 MNVLNGALQSMGQVLQSYEL-------------MVYANGSITLYAQNLQLASWCVDSARNWPSER 348
            :.|.|        :::|..|             .::.||:|......:...| |..:.|::|.:.
 Worm   149 IIVFN--------MVKSNRLAHEDLLSAVRAPARIHYNGTIVASHPAVHTVS-CEINIRHFPLDD 204

  Fly   349 VTCDIELGLNGQEGQENVAL-IYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGM 412
            ..|.||:. :...|||.:.| .:.|...     ||......|....::|      |:.:|..:|:
 Worm   205 QRCAIEIA-SWAYGQEKIRLHAHTDHSL-----EHYKRNEEWHLLNLNV------SEEKYEHEGV 257

  Fly   413 MQKMTGDVAIEFTLQRNRSFYMTVFYLP-LIACQMFLILSFVLRST-----RRSSLILIALL-IA 470
               ...:|..|.:|:|...|||.....| .|.|.:.::..|...||     .|.:|.:.|:| :|
 Worm   258 ---EVSEVKFEISLKRRPLFYMVTLTFPSYIMCAISVVGLFARFSTTGEREERFTLGVTAILTMA 319

  Fly   471 AWGLMYMTR--YASPHYVPPMMTAY--------KVIMMTTTYCYILH 507
            ...|:...:  ::|.|.  |::.||        .:..|||.....:|
 Worm   320 VLSLVVSEKVPHSSTHV--PLLVAYFLFNMVIVSIAAMTTGIVMKVH 364

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 7/20 (35%)
Neur_chan_LBD 212..429 CDD:280998 53/234 (23%)
pbo-5NP_001024240.1 Neur_chan_LBD 68..272 CDD:280998 53/232 (23%)
Neur_chan_memb 306..>364 CDD:280999 14/60 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.