DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-42

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_497489.3 Gene:lgc-42 WormBaseID:WBGene00021437 Length:412 Species:Caenorhabditis elegans

Alignment Length:387 Identity:66/388 (17%)
Similarity:130/388 (34%) Gaps:135/388 (35%)


  Fly   228 ENASMPANLS-----SISFHFQTRSLA-YEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFE 286
            ::..||.|.:     .:.|.|...||. :..|.......|::.|.|:|             :|..
 Worm    27 QDKPMPRNGNPKAPLQVHFGFYVESLGNFRATEMTYDMDMYLYMSWQD-------------DSMR 78

  Fly   287 HPDL------------RIWKPHMNVLNGALQSMGQV-LQSYELMVYANGSITLYAQNLQLASWCV 338
            |.:.            :||.|.:...|.......:| :.::.:.:...|:|: |...:.|...|.
 Worm    79 HNETEHVLVNDKDILDKIWLPDLYFANARTAYFHKVTVHNFNMFISPQGTIS-YGTRVTLNLACN 142

  Fly   339 DSARNWPSERVTCDIE-LGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVEND 402
            ...:::|.:..||.|: :.....:.:.||:...:|   ||..|..::.|      :..:..::.|
 Worm   143 LDLKDYPLDYQTCYIKVISYAHVKNEMNVSWFPND---PIRFNPEIDLP------EFHIRALDKD 198

  Fly   403 SQRRYNPKGMMQKMTGDVAI--EFT-------LQRNRSFYMTVFYLPLIACQMFLILSFVLRSTR 458
                |.....:..:|.:.:.  ||:       |:|...|::...|:|                  
 Worm   199 ----YCNGVFLYTLTHNSSRVGEFSCLLGMLKLKRAIGFHLVQSYIP------------------ 241

  Fly   459 RSSLILIALLIA-AWGLMYMTRYASP--------------------HYVPPMMTAYKVIMMTTTY 502
                  ..|::| :|...::.|.|.|                    .|..|.::..|.|      
 Worm   242 ------TGLIVAISWVSFWIDRRAVPARVSLSFTTLLTLSTQGNGIRYALPAVSYAKAI------ 294

  Fly   503 CYILHICIIWLDLYPPRSKAPGWLVR--VINSNVLRCILGLRFSDSTDYCDIQENPWHHMAK 562
            .|...:|::::.         |.|:.  .:||.:.|.                 |.::|||:
 Worm   295 DYFYGVCMLFIF---------GVLLEFAAVNSYMRRA-----------------NKYNHMAE 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 42/230 (18%)
lgc-42NP_497489.3 Neur_chan_LBD 36..192 CDD:280998 32/179 (18%)
Neur_chan_memb 239..401 CDD:280999 23/149 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.