DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-45

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001335538.1 Gene:lgc-45 WormBaseID:WBGene00021146 Length:1046 Species:Caenorhabditis elegans

Alignment Length:489 Identity:97/490 (20%)
Similarity:181/490 (37%) Gaps:113/490 (23%)


  Fly   157 VYIPGFKKEPLLQFID------------EAPLVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPI 209
            :|:||...|.:.:.||            |.|:.:|..:....|.|.             :.:|..
 Worm   601 LYLPGICSEYVPKAIDEFNSSSFEGIEIEGPIGVNITALELAGVNL-------------TSLADK 652

  Fly   210 VKEETKTEKLLSHLNIQAENA-----------------SMP-------------ANLSSISFHFQ 244
            ::.:|:.:::||..|...:|.                 |.|             ..:.|:| :||
 Worm   653 LRNDTEVDEILSRTNGSTKNLGGSFILPVLNKNQYDPFSAPIVFQGSAVVVRFGIYIESMS-NFQ 716

  Fly   245 TRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQ 309
            |.::.|:..       :::||.|||:||| .|.|...|...|....:||:|.....|.......:
 Worm   717 TSTMDYDMD-------IYLMMSWRDARLV-NPYDKPILVKEEDILEKIWRPDPFFANAKEAEFHE 773

  Fly   310 V-LQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQ 373
            | ..::.:.::.:| :.||...:::...|......:|.::.|||: |..:.....|.|...:..:
 Worm   774 VTFLNFLMRIFPDG-LVLYETRVKIKPSCNLILCKYPHDKQTCDL-LIKSFAYPVETVRFEWFTR 836

  Fly   374 RK-PIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVF 437
            || .|..|..|..|      ::.:...|..:.......|....:..    .|.|:|:..|::...
 Worm   837 RKDAIDKNPDVKLP------ELYIDRYETTTCPNERKSGAFSCLRA----VFRLKRDVGFHIAQT 891

  Fly   438 YLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMM---- 498
            |:|.....||..:...|........|.:|:.:.   |...|..|......|.::..|.|.:    
 Worm   892 YIPTSLALMFSWVGVWLPEEFMEGRIGVAITVL---LTLSTESAGAREHLPSVSYLKAIDLWFGF 953

  Fly   499 TTTYCYILHICIIWLDLYPPRSKAPGWLVRVINSNVLRCILGLRFSDSTDYCDIQE------NPW 557
            .|.:.:...:..:::..:..|            :|.|:...|.:.:|.|:  :|:|      ..:
 Worm   954 ITGFVFFTLLQTLFVIGFDKR------------ANQLKKWAGRKTADITE--EIREALLQKATRY 1004

  Fly   558 HHMAKILNN-------LSSILVIITFAIVDITSG 584
            |...:.|:|       ||.||.::.:..| .|.|
 Worm  1005 HKTGRYLDNFCRVFYPLSFILFLLMYYFV-FTEG 1037

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 11/46 (24%)
Neur_chan_LBD 212..429 CDD:280998 52/249 (21%)
lgc-45NP_001335538.1 Neur_chan_LBD 687..>969 CDD:332142 62/306 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.