DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-40

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_508428.2 Gene:lgc-40 WormBaseID:WBGene00020767 Length:494 Species:Caenorhabditis elegans

Alignment Length:172 Identity:35/173 (20%)
Similarity:61/173 (35%) Gaps:30/173 (17%)


  Fly   199 FDGYGSEIAPIVK---EETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTR 260
            |:.......|:.|   ::.|.|.|.:......:...:|.|:        |.|:..|..||.....
 Worm    20 FESADLAFIPLTKAFLDKLKNETLYNRFATPTQYDGVPTNV--------TLSMFIEGMSSFSAQT 76

  Fly   261 M--HMMMH----WRDSRLVWKP------EDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQS 313
            |  |:.::    |.|.||....      .|....:...|||:..    .|..:.|.|.:..  .:
 Worm    77 MDYHLDVYFQEEWYDHRLAHNASAPILVRDLTVFKMMWHPDVYF----ANARSAAFQDITD--DN 135

  Fly   314 YELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIEL 355
            :.:.||.||.: .|...:.:.|.|......:|.:...|.:.:
 Worm   136 FLVWVYPNGRV-WYDARISIVSSCNMDLWKYPLDSQECALRI 176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 32/157 (20%)
lgc-40NP_508428.2 LIC 9..490 CDD:273305 35/173 (20%)
Neur_chan_LBD 44..242 CDD:280998 29/149 (19%)
Neur_chan_memb 249..487 CDD:280999
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.