DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-53

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_741945.3 Gene:lgc-53 WormBaseID:WBGene00020657 Length:497 Species:Caenorhabditis elegans

Alignment Length:340 Identity:66/341 (19%)
Similarity:127/341 (37%) Gaps:83/341 (24%)


  Fly   125 MRRVATNQEPNLVSLYDPTPIEIVQNQNGELFVY--IPG--------------FKKEPLLQFIDE 173
            :..:|.|||.:         |::.|......|.|  ||.              |:||.|    ||
 Worm    24 LAEIAANQEHS---------IQLDQMPPDRTFHYPNIPSSQHDRRREGGKRKKFRKERL----DE 75

  Fly   174 APLVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSS 238
            ....||    .:...|..:..:|   |.|.....|    ...:.:::..|.:|        :::.
 Worm    76 PCTAIN----ETLRKNLLQELFD---DSYDKNNLP----SANSTEVIVELTVQ--------SITE 121

  Fly   239 ISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFG----SLESFEHPDLRIWKPHMNV 299
            ||           :.||..:..:.....|||.||.:...::.    ||.|.:.|.:  |.|::..
 Worm   122 IS-----------EFSSSFKADVWFSQIWRDPRLDFSDRNYCLKNISLASHKLPTM--WSPNVCF 173

  Fly   300 LNG-ALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDI---ELGLNGQ 360
            :|. .::......|:..|:::.||::.|..: :.|...|......:|.:|.:|::   ....|..
 Worm   174 VNSKKVEIHASPSQNILLLIFPNGTVWLNFR-VSLTGPCKLDLTYFPMDRQSCNLVFESYSYNTA 237

  Fly   361 EGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFT 425
            |    |.:::.|......|:     |...:.....:|.:|:.:.......|:..::    .::||
 Worm   238 E----VRIVWRDWDAVTIPD-----PDSKNLPDFELVNIEHMNATLVYTAGLWDQL----EVKFT 289

  Fly   426 LQRNRSFYMTVFYLP 440
            .:|...:|:...|:|
 Worm   290 FRRLYGYYVLQAYMP 304

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 19/82 (23%)
Neur_chan_LBD 212..429 CDD:280998 40/225 (18%)
lgc-53NP_741945.3 LIC 87..489 CDD:273305 48/261 (18%)
Neur_chan_LBD 88..294 CDD:280998 44/248 (18%)
Neur_chan_memb 302..486 CDD:280999 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.