DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-50

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_498637.3 Gene:lgc-50 WormBaseID:WBGene00020605 Length:491 Species:Caenorhabditis elegans

Alignment Length:345 Identity:77/346 (22%)
Similarity:136/346 (39%) Gaps:80/346 (23%)


  Fly   221 SHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESF 285
            :||..:||..::     :|..|.|..|...|.|.......|:..: |:|.||           ||
 Worm    45 THLLPEAEGVNV-----TIELHVQGVSGISEITGDFSLDVMYSEI-WQDPRL-----------SF 92

  Fly   286 EHPDL-------------RIWKPHMNVLNGALQSM-GQVLQSYELMVYANGSITLYAQN--LQLA 334
            :|.::             :||.|...::|....|: ....::..:::|.||   |...|  |.:.
 Worm    93 KHLNVCATNITLKSDFRKKIWTPDTCIINSKSSSIHSSPSENTFVILYENG---LVWSNFRLNVK 154

  Fly   335 SWCVDSARNWPSERVTCDIEL---GLNGQEGQENVALIYDDQRKPIAPNEHVNTPS----GWSFT 392
            :.|..:.:.:|.:.::|:|.|   ..|..|    |.|::.|  .||...|.|..|.    |||  
 Worm   155 TPCSVNLKMFPFDSLSCEIVLESYSFNTDE----VRLMWHD--VPITMMEKVELPDFDLIGWS-- 211

  Fly   393 QMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLP--LIACQMFLILSFVLR 455
                    .|.||...|.|:..:    ..::||..|...||:...|.|  |.....::...|.:|
 Worm   212 --------TDHQRLEYPNGIWDR----AKVKFTFARRYGFYLFQSYFPTSLTVISSWVGFFFDVR 264

  Fly   456 STRRSSLILIALLIA---AWG--LMYMTRYASPHYVPPMMTAYKVIMMTTTYCYILHICII---- 511
            |......:.::.|:|   .:|  |.::.|.:   |: ..:..:.:..:...:|.::.:.|:    
 Worm   265 SVSARITLGVSSLLALTFQFGNVLRHLPRVS---YI-KCLDVWMIFSVIFIFCTLVELAIVCQLN 325

  Fly   512 -WLDLYPPRSKAPG-WLVRV 529
             |.......||..| ||.::
 Worm   326 RWERERQIGSKVLGHWLNQI 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 55/231 (24%)
lgc-50NP_498637.3 LIC 34..483 CDD:273305 77/346 (22%)
Neur_chan_LBD 34..237 CDD:280998 55/232 (24%)
Neur_chan_memb 245..480 CDD:280999 20/106 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.