DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-54

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001343648.1 Gene:lgc-54 WormBaseID:WBGene00020528 Length:493 Species:Caenorhabditis elegans

Alignment Length:347 Identity:65/348 (19%)
Similarity:124/348 (36%) Gaps:92/348 (26%)


  Fly   200 DGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMM 264
            |.|.....|:     ||...:..:....:|.   |.:|.||..| |..|.:.|.           
 Worm    62 DNYNKNTVPL-----KTSATVVSVEFGIQNI---AQVSEISASF-TLDLLFSQI----------- 106

  Fly   265 MHWRDSRLVWKPEDFGSLESFEH-----PDL--------RIWKPHMNVLNGALQSM-GQVLQSYE 315
              |.|.||           .|:|     .:|        ::|.|::..:|.....: .....:..
 Worm   107 --WHDPRL-----------RFDHLTNCLQNLTLGYSMVEKLWTPNVCFVNSKKTEIHSSPTPNIF 158

  Fly   316 LMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDI----------ELGLNGQEGQENVALIY 370
            ||:|.||::.: ...||:.|.|:.....:|.:.:.|::          ::.||.:|.|.    ::
 Worm   159 LMIYPNGTVWV-NYRLQVQSPCMVDLVLFPMDIMNCELIIESYAYNAAKVKLNWREWQP----VF 218

  Fly   371 DDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMT 435
            ...:..::           .||...:...:|..:   ...|...::|    :..|..|...||:.
 Worm   219 SIAKSKLS-----------DFTLYGLQWTKNSFE---YAAGQWDQLT----VSLTFSRAYGFYIL 265

  Fly   436 VFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMT-RYASPHYVPPMMTAYKVI--- 496
            ..|:|..:......:||.:......:.|.:.:.    .||.:| :|.:.....|.:...|.|   
 Worm   266 QMYIPTYSSVFLSFVSFWIDLKALPARITLGVS----SLMALTFQYGNVAKNLPRVGYVKSIDVY 326

  Fly   497 -MMTTTYCYILHI---CIIWLD 514
             ::||.:.::..|   .:.:||
 Worm   327 MVLTTAFIFLTMIEVAFVCYLD 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 43/241 (18%)
lgc-54NP_001343648.1 Neur_chan_LBD 55..474 CDD:332142 65/348 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.