DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-18

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_510029.3 Gene:lgc-18 WormBaseID:WBGene00011360 Length:399 Species:Caenorhabditis elegans

Alignment Length:353 Identity:66/354 (19%)
Similarity:128/354 (36%) Gaps:79/354 (22%)


  Fly   145 IEIV----QNQNGELFVYIPGFKKEPLLQFIDEAPLVINYLSFSSFGSNTARWFYDCGFDGYGSE 205
            |||.    ||::    :|:|                     .:::|..|..:...|. |..|.:.
 Worm    10 IEITTCFYQNES----LYVP---------------------EWNNFLENQVKLIKDV-FTNYDNT 48

  Fly   206 IAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAY----------EQTSSLLQTR 260
            ::|:..:...|:.:       ..|...|..     |:: |.||.|          |:.|.:|:  
 Worm    49 LSPVYTKIDPTQPI-------GYNPLAPKR-----FNY-TVSLYYLKLVEVIEPEEKVSVVLE-- 98

  Fly   261 MHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQ-SYELMVYANGSI 324
              |..:|.|.|:.|....:|.::.......::|.|.:::..  :..:..... .:.::...|...
 Worm    99 --MAEYWYDPRIAWDSSLYGDIKMLHMRQDKVWSPTLSLFR--INDIADFRDPDFRMVCVENTGH 159

  Fly   325 TLYAQNLQLASWCVDSARNWPSERVTCDIE--LGLNGQEGQENVALIYDDQRKPIAPNEHVNTPS 387
            |....:::::..|......:|.:..||.|:  :.|...:..|..:.||:.........:..|  |
 Worm   160 TYTTLSVKISLNCPLDVSMFPYDSQTCRIQFNMPLFFMQQVEMFSQIYEGILNSTVWEKMGN--S 222

  Fly   388 GWSFTQM--SVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLIL 450
            .|....:  ||.|:...     :..|.||..|    .|..::||..:|:.:...|........|:
 Worm   223 EWELANLTHSVELLSYG-----DGLGDMQLAT----FEIRIRRNPMYYIYMIIFPSFIINALSII 278

  Fly   451 SFVLRSTRRSSLILIALLIAAWGLMYMT 478
            ...|:.|.:.|.:.:.|.    .:|.||
 Worm   279 GVFLKKTDKMSKLNVGLT----NIMTMT 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 9/50 (18%)
Neur_chan_LBD 212..429 CDD:280998 42/232 (18%)
lgc-18NP_510029.3 Neur_chan_LBD 34..258 CDD:280998 47/255 (18%)
Neur_chan_memb 265..>341 CDD:280999 9/43 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.