DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-17

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_510028.2 Gene:lgc-17 WormBaseID:WBGene00011359 Length:401 Species:Caenorhabditis elegans

Alignment Length:422 Identity:86/423 (20%)
Similarity:156/423 (37%) Gaps:110/423 (26%)


  Fly   220 LSHLNIQAEN------ASMPANLSSI---SF-----HFQTRS--------LAY-----------E 251
            :.:||.| :|      |:....:||:   ||     |..||:        |.|           |
 Worm    30 IDYLNHQ-DNLTRDLFANYDPTISSVYSSSFDYEPSHNHTRTVDRWNYTILLYYLKLVEVQEPEE 93

  Fly   252 QTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVL----Q 312
            :.|.:|:    ::..|.|.||.|....:.::.:......::|.|.::..     .:.:::    |
 Worm    94 KVSVVLE----LVEQWYDPRLSWNSSLYSNIPTVFVRQEKVWSPTLSAF-----GVNEIIDFRDQ 149

  Fly   313 SYELMVYAN-GSITLYAQNLQLASWCVDSARNWPSERVTCDIELGL---NGQEGQENVALIYDDQ 373
            .:.::...: |.|..|. :::::|.|......:|.:..||.|...|   |.::     ..|.::.
 Worm   150 DFRIVSIDDIGYIQDYL-SVRVSSNCPMDVSRFPFDSQTCQICFCLPIFNIRQ-----VKILNEI 208

  Fly   374 RKPIAPNEHVNT--PSGWSFTQMSVVLVENDSQRRYNPK-GMMQKMTGDVAI-EFTLQRNRSFYM 434
            .:.|...:.:.|  .|.|..    |.|.....|.:|:.. |.|     |:|: |.|::||..:|:
 Worm   209 YEGILQEKIIKTMGNSEWKV----VSLTNRVEQLKYDDDYGNM-----DLAVFEITIRRNPLYYI 264

  Fly   435 TVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRY--ASPHYVP-----PMMTA 492
            .:...|........|:...|:|..:.|.:.:.|.    .:|.||..  .....:|     |::..
 Worm   265 YMIVFPSFVINGISIVGIFLKSADKMSKLNVGLT----NIMTMTFILGVMADKIPRTGSIPLLGI 325

  Fly   493 YKVIMMTTTYCYILHICII-----WLDLYPPRSKAPGWLVRVINSNVLRCILGLRFSDSTDYCDI 552
            |.:|.:......|..:.:|     |.   .||.|    |.:...|..|...||            
 Worm   326 YIIINLLIMIIAITVVVLITELRQWA---VPRLK----LKKSYISRKLETFLG------------ 371

  Fly   553 QENPWHHMAKILNNL---SSILVIITFAIVDI 581
              :|..:...||...   ::..|||.|...|:
 Worm   372 --SPIEYTCAILLEFLTTANFFVIIGFWFEDL 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 52/254 (20%)
lgc-17NP_510028.2 Neur_chan_LBD 36..260 CDD:280998 51/249 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.