DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-16

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_510027.2 Gene:lgc-16 WormBaseID:WBGene00011358 Length:401 Species:Caenorhabditis elegans

Alignment Length:475 Identity:87/476 (18%)
Similarity:170/476 (36%) Gaps:108/476 (23%)


  Fly   136 LVSLYDPTPIEIVQNQNGELFVYIPGFKKEPLLQFIDEAPLVINYLSFSSFGSNTARWFYDCGFD 200
            :|:|:..:.|....:..|   :|.||:               |:||:.....:|..       |.
 Worm     6 IVTLFSFSDISAFYHDPG---LYAPGW---------------IDYLNLQENLTNDL-------FA 45

  Fly   201 GYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFH---FQTRSLAYEQTSSLLQTRMH 262
            .|...|:.:..:....|.|       .:|   |..:...::.   :..:.:..::.:..:...:.
 Worm    46 NYDPTISTVYADIADWEPL-------GDN---PRTIDRWNYTILLYYLKLVEVQEPAEKVSVVLE 100

  Fly   263 MMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNV--LNGALQSMGQ--VLQSYELMVYANGS 323
            ::..|.|.||.|....:.::.:......::|.|.::.  :|..:....|  .|.|.:...|.|..
 Worm   101 LVERWYDPRLSWNISLYSNVSTIFARQEKVWSPTLSPFGVNEIIDFRDQDFRLISIDFTGYLNDY 165

  Fly   324 ITLYAQNLQLASWCVDSARNWPSERVTCDIELGL---NGQEGQENVALIYDDQRKPIAPNEHVNT 385
            :     ::::::.|......:|.:..||.|...|   |.::     ..|.::..:.|...:.:.|
 Worm   166 L-----SVRVSANCPMDVSRFPFDSQTCQIRFCLPIFNIRQ-----VKILNEIYEGILQEKIIKT 220

  Fly   386 --PSGWSFTQMSVVLVENDSQRRYNPK-GMMQKMTGDVAI-EFTLQRNRSFYMTVFYLPLIACQM 446
              .|.|..    |.|.....|.:|:.. |.|     |:|: |.|::||..:|:.:...|......
 Worm   221 MGNSEWKV----VSLTNRVEQLKYDDDYGNM-----DLAVFEITIRRNPLYYIYMIVFPSFVING 276

  Fly   447 FLILSFVLRSTRRSSLILIALLIAAWGLMYMTRY--ASPHYVP-----PMMTAYKVIMMTTTYCY 504
            ..|:...|:|..:.|.:.:.|.    .:|.||..  .....:|     |::..|.:|.:......
 Worm   277 ISIVGIFLKSADKMSKLNVGLT----NIMTMTFILGVMADKIPRTGSIPLLGIYIIINLLIMIIA 337

  Fly   505 ILHICII-----WLDLYPPRSKAPGWLVRVINSNVLRCILGLRFSDSTDYCDIQENPWHHMAKIL 564
            |..:.:|     |.   .||.|    |.:...|..|...||              :|..:...||
 Worm   338 ITVVVLITELRQWA---VPRLK----LKKSYMSRKLETFLG--------------SPIEYTCAIL 381

  Fly   565 NNL---SSILVIITFAIVDI 581
            ...   ::..|:|.|...|:
 Worm   382 LEFLTTANFFVMIGFWFEDL 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 11/55 (20%)
Neur_chan_LBD 212..429 CDD:280998 40/231 (17%)
lgc-16NP_510027.2 Neur_chan_LBD 36..260 CDD:280998 45/260 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.