DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-15

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_510025.2 Gene:lgc-15 WormBaseID:WBGene00011356 Length:399 Species:Caenorhabditis elegans

Alignment Length:436 Identity:78/437 (18%)
Similarity:138/437 (32%) Gaps:132/437 (30%)


  Fly   199 FDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHM 263
            |.||.:.|:|:..:...|:.|       ..:...|...:.....|..:.:...:....:...|.:
 Worm    43 FSGYDATISPVYTKVDPTQPL-------GHDPDAPGRWNYTLLLFSLKLVEVTEPQEKVSVVMEV 100

  Fly   264 MMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGA--------------LQSMGQVLQSY 314
            |.:|.|:||.|..||:..:.|.......:|.|.::....:              :.|.|.|....
 Worm   101 MEYWFDARLTWNKEDYDDIASIYTRQANVWSPTLSAFGVSELVDLRDTDFRLVGITSYGMVNTYV 165

  Fly   315 ELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAP 379
            .::|.||..:.:|               .:|.:..||.|...:                  |:..
 Worm   166 SVLVSANCPMDVY---------------KFPFDYQTCQIRFCI------------------PVFT 197

  Fly   380 NEHVNTPSGWSFTQM-SVVLVENDSQRRYNPKGMMQKMTGDV---------------AIEFTLQR 428
            :..|..     |.:: :.||..|..:...|.:..:..:|..|               ..|..::|
 Worm   198 SYEVEI-----FNEIYAGVLTSNAWKTMGNSEWNLVNLTHRVETLKYDDGFANLDLGTFEIKIRR 257

  Fly   429 NRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRY--ASPHYVP---- 487
            |..:|:.:...|.....:..|:...|:...:.|.:.:.|.    .:|.||..  .....:|    
 Worm   258 NPLYYIYMIIFPSFIINVVSIIGVFLKGADKMSKLNVGLT----NIMTMTFILGVMADKIPRTGT 318

  Fly   488 -PMMTAYKVIMMTTTYCYILHICIIWLDLYPPRSKAPGWLVRVINSNVLRCILGLRFSDSTDYCD 551
             |::..|.:     |...|:.|.|              .:|.||| .:.||...:.....|    
 Worm   319 IPLLGVYII-----TNLVIMLIAI--------------GIVTVIN-ELRRCASPVLKRKQT---- 359

  Fly   552 IQENPWHHMAKILNNLSS------------ILVIITFAIVDITSGF 585
                      |:...|.|            ||.::|||...|..||
 Worm   360 ----------KLSRKLESFIGTPLEYTCAAILELLTFANFAIMIGF 395

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 38/247 (15%)
lgc-15NP_510025.2 Neur_chan_LBD 35..259 CDD:280998 44/261 (17%)
Neur_chan_memb 266..>370 CDD:280999 25/142 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.