DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-14

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_510024.2 Gene:lgc-14 WormBaseID:WBGene00011355 Length:400 Species:Caenorhabditis elegans

Alignment Length:437 Identity:85/438 (19%)
Similarity:158/438 (36%) Gaps:94/438 (21%)


  Fly   177 VINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISF 241
            |..|..|....:|..|..    |:||...::|:..:       :..|.....:...|...:....
 Worm    24 VPKYHDFIESQTNLTRDL----FNGYDPTVSPVYSK-------IDPLQPLGYDPDAPKRYNYSIM 77

  Fly   242 HFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQS 306
            .:..:.:...:.:..:...|.:|.:|.|.||.|....:..:::|......:|.|.::.. ||.:.
 Worm    78 LYSLKLVEVNEPAEKVAVVMEIMEYWYDIRLSWNASLYDDIDTFYTRQSNVWSPTLSAF-GADEL 141

  Fly   307 MGQVLQSYELM-VYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGL---NGQE----GQ 363
            :......:.:: |.:||.|..|. :::::|.|..:...:|.:..||.|:..|   |..|    .:
 Worm   142 VDLRDPDFRMVCVNSNGYIYDYI-SVRVSSSCPMNVYKFPFDYQTCQIKFCLPIFNSVEIQIFNE 205

  Fly   364 ENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTG----DVAI-E 423
            ..|.::..|..:.:..:|       |..|.:|            |....:|...|    |:.| |
 Worm   206 IYVGVLMSDLWETMGNSE-------WKLTNLS------------NRVETLQYNDGFGNLDLGIFE 251

  Fly   424 FTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRY--ASPHYV 486
            .|::||..:|:.:...|.....:..|:...|:...:.|.:.:.|.    .:|.||..  .....:
 Worm   252 ITIKRNPLYYIYMIIFPSFIINVVSIIGVFLKGADKMSRLNVGLT----NIMTMTFILGVMADKI 312

  Fly   487 P-----PMMTAYKVIMMTTTYCYILHICIIWLDLYPPRSKAPGWLVRVINSN------VLRCILG 540
            |     ||:..|.::.        |.|.||.:.:....::...||...:..|      .|...:|
 Worm   313 PRTGTIPMLGVYIIVN--------LAIMIIAIGIVTMITELRHWLAPFLKRNETKFSRKLETFIG 369

  Fly   541 --LRFSDSTDYCDIQENPWHHMAKILNNLSSILVIITFAIVDITSGF 585
              |.|:     |.|                 ||.:.|.||..:..||
 Worm   370 PPLEFT-----CAI-----------------ILEVFTCAIFGVMIGF 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 4/14 (29%)
Neur_chan_LBD 212..429 CDD:280998 42/230 (18%)
lgc-14NP_510024.2 Neur_chan_LBD 34..258 CDD:280998 49/256 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.