DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-13

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_510023.2 Gene:lgc-13 WormBaseID:WBGene00011354 Length:399 Species:Caenorhabditis elegans

Alignment Length:400 Identity:69/400 (17%)
Similarity:135/400 (34%) Gaps:104/400 (26%)


  Fly   140 YDPTPIEIVQNQNGELFVYIPGFKKEPLLQFIDEAPLVINYLSFSSFGSNTARWFYDCGFDGYGS 204
            |||.             :|:|.::               :||  .:.|:.||..     |..|..
 Worm    19 YDPQ-------------LYVPKYR---------------DYL--EAQGNLTADL-----FKNYEK 48

  Fly   205 EIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRD 269
            :::| |.....|.|.|.:      :...|...:...|.:..:.:...:....:...:.:|.:|.|
 Worm    49 DVSP-VYAWFDTSKPLGY------DPDAPQRYNYTLFLYNLKLIQVNEPEEQVSVVLELMEYWYD 106

  Fly   270 SRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVL----QSYELMVYAN-GSITLYAQ 329
            .||.|...|:.::.:......:||.|.:...     .:.:::    |.:.|:...| |.|..|. 
 Worm   107 PRLSWNASDYKNVTAIFTRQEKIWSPTLTPF-----GVNEIIDFRDQDFRLVCIDNLGMIYDYL- 165

  Fly   330 NLQLASWCVDSARNWPSERVTCDIELGL------------NGQEGQENVALIYDDQRKPIAPNEH 382
            ::::::.|......:|.:..||.|...|            ...||..|.::.            .
 Worm   166 SVRVSANCRMDVTKFPFDSQTCQIRFSLPIFSYLEVKIYTELYEGINNYSMF------------E 218

  Fly   383 VNTPSGW---SFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAI-EFTLQRNRSFYMTVFYLPLIA 443
            |...|.|   :.|.....|..||            :...::|: |..:.||..:|..:...|...
 Worm   219 VMGNSEWELINLTNRVDFLTYND------------RFDVELAVYEIKIARNPLYYFYMIVFPSFV 271

  Fly   444 CQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRY--ASPHYVP-----PMMTAYKVIMMTTT 501
            .....|:...::...:.|.:.:.|.    .:|.||..  .....:|     |::..|.::.:...
 Worm   272 INSVSIVGVFIKGADKMSRLNVGLT----NIMTMTFILGVMSDKIPRTGNVPLLGIYIIVNLLIM 332

  Fly   502 YCYILHICII 511
            ...|:.:.||
 Worm   333 LVAIIIVTII 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 9/51 (18%)
Neur_chan_LBD 212..429 CDD:280998 40/238 (17%)
lgc-13NP_510023.2 Neur_chan_LBD 38..258 CDD:280998 47/262 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.