DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and acr-20

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001122627.1 Gene:acr-20 WormBaseID:WBGene00000059 Length:556 Species:Caenorhabditis elegans

Alignment Length:340 Identity:74/341 (22%)
Similarity:133/341 (39%) Gaps:80/341 (23%)


  Fly   237 SSISFHFQTRSLAYEQTSSLLQTRMHMMMH------WRDSRLVWKPEDFGSLESFEHPDLRIWKP 295
            |.|..||   |:...|..|:.:.:..:|::      |.|..|.|.||.||::.....|...||.|
 Worm    47 SPIEVHF---SMELYQIISVNEPQQFLMLNAWVVERWTDRLLGWDPEKFGNVTEIMLPHHFIWLP 108

  Fly   296 --------------HMNVLNGALQSMGQVLQSYELMVYANGSI--TLYAQNLQLASWCVDSARNW 344
                          :..:|:..:.::|:          .||:.  .||....:|:  |:.:.|.:
 Worm   109 DTTLYNSLVMKDDENRRLLHAKVTTLGE----------GNGAFIELLYPTIYKLS--CLLNLRFF 161

  Fly   345 PSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEH--VNTPS-----GWSFTQMSVVLVEND 402
            |.:..:|.:   |.|....:|..:.|      .|.||.  :.|.:     ||:....||:..|| 
 Worm   162 PFDVQSCRL---LFGSWTFDNTKIDY------FAFNESQAIGTTNCIENEGWNVLSTSVIRHEN- 216

  Fly   403 SQRRYN--PKGMMQKMTGDVAIEF--TLQRNRSFYMTVFYLPLIACQMFLILSFVLRST----RR 459
               :|:  |...       ..:||  |:||...:|:....:|........|:.|...|:    |.
 Worm   217 ---KYDCCPNNY-------TLLEFRLTIQRKPLYYIINLIIPTSIITFISIIGFFSTSSINEPRE 271

  Fly   460 SSLIL-IALLIAAWGLMYMTRYASP---HYVPPMMTAYKVIMMTTTYCYILHICIIWL----DLY 516
            ..:.| |..|::...|::|.....|   .::|.:...|..:::..::..|....:|::    :|.
 Worm   272 EKITLGITTLLSMSILIFMVSDKMPSTSSFIPLIGLFYTSMILLISFSTICSSVVIYVQKQGNLG 336

  Fly   517 PPRSKAPGWLVRVIN 531
            .|.||....:.|.:|
 Worm   337 NPPSKNFMNIARAVN 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 52/225 (23%)
acr-20NP_001122627.1 Neur_chan_LBD 24..238 CDD:280998 52/226 (23%)
Neur_chan_memb 272..>329 CDD:280999 10/57 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.