DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-30

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_500015.3 Gene:lgc-30 WormBaseID:WBGene00019069 Length:529 Species:Caenorhabditis elegans

Alignment Length:320 Identity:61/321 (19%)
Similarity:122/321 (38%) Gaps:56/321 (17%)


  Fly   251 EQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYE 315
            :|.::|.....::.:||.|..:.||||.||.:|....|...||||...:.:.....:........
 Worm   105 DQRNNLATVSAYLDVHWNDDFIKWKPEIFGGIERIFVPIKWIWKPEFYMYHSVYGRVPDYAPDAS 169

  Fly   316 LMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELG--------LNGQEGQENVAL--IY 370
            ..::.||.:.::. ::...|:|..:.:.:|.:..||....|        :|....::.:||  .|
 Worm   170 AELHYNGLVRMFV-SISSKSFCPINFKRFPFDSQTCSFSCGSWAYQSNIVNLVAAKQEIALEDFY 233

  Fly   371 DDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMT 435
            |:|.              |..|...:.   |.:.|..:.......|   |.::..|:|...:|:.
 Worm   234 DNQE--------------WLLTDARLF---NGTTRNVSAANESFSM---VYMQLDLKRQSFYYVF 278

  Fly   436 VFYLPLIACQMFLILSF---VLRSTRRSS------LILIALLIAAWGLMYMTRYASPHYVPPMMT 491
            ....|.....:..::.|   :..:.||.|      :.|:::.:....|:...::|. ..||....
 Worm   279 NLVFPTTLVSLVAVIGFHAPINATGRRESKFRLGIMTLLSMSVMLLMLVGEMKFAM-ESVPGQRG 342

  Fly   492 AYKVIMMTTTYCYILHICIIWL--------------DLYPPRSKAPGWLVRVINSNVLRC 537
            ::..:.:...| |:..|||:.:              .|..|..::..|.:|.:.:..|.|
 Worm   343 SFSDVPLMGIY-YMTLICIVSIATCTSSIFVHLEKFALRNPSWQSVPWYIRWLAAKKLFC 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 39/188 (21%)
lgc-30NP_500015.3 Neur_chan_LBD 68..272 CDD:280998 39/188 (21%)
Neur_chan_memb 280..>399 CDD:280999 19/121 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.