DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and acc-3

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_508810.2 Gene:acc-3 WormBaseID:WBGene00018880 Length:517 Species:Caenorhabditis elegans

Alignment Length:332 Identity:69/333 (21%)
Similarity:127/333 (38%) Gaps:49/333 (15%)


  Fly   200 DGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMM 264
            |..|.|:.  ..::|..||||::.. .....|....:..|....|..:...|.||. ....:::.
 Worm    56 DEDGEELC--TSDKTIIEKLLNNYK-SFRTPSESGVIVWIEVWVQEVNSVNEITSD-FDMDIYVT 116

  Fly   265 MHWRDSRLVWK---PEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQ-VLQSYELMVYANGSIT 325
            ..|.||.|.::   |..:....:.|..| :||||:...:|....::.: ..::..||:|.||::.
 Worm   117 ELWMDSALRYEHLNPCKYNLSLNSEILD-QIWKPNTVFINSKSANIHKSPFKNVFLMIYPNGTVW 180

  Fly   326 LYAQNLQLASWCVDSARNWPSERVTCDIEL---GLNGQEGQENVALIYDDQRKPIAPNEHVNTPS 387
            : ...:|:...|......:|.::.:|.:.|   ..|.||                ...:.:|..:
 Worm   181 V-NYRVQVKGPCSMDFSAFPMDQQSCHLTLESFSYNNQE----------------VDMQWMNWTT 228

  Fly   388 GWSFTQMSVVL----VENDS---QRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQ 445
            ..|..:..:||    :.|.|   :....|.|:..::|    :.|...|...:|:...|:|.....
 Worm   229 PLSLLKKEIVLPDFVMSNYSTSLKHEIYPAGVWNELT----MTFVFSRRYGWYIFQAYIPTYLTI 289

  Fly   446 MFLILSFVL------RSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTTTYCY 504
            ....:||.|      ..|......|:||......:|......|  || ..:..:.::.:|..:|.
 Worm   290 FISWISFCLGPKMIPARTMLGVNSLLALTFQFGNIMRNLPRVS--YV-KALDVWMLVCLTFVFCS 351

  Fly   505 ILHICII 511
            :|.:.||
 Worm   352 LLELAII 358

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 47/231 (20%)
acc-3NP_508810.2 Neur_chan_LBD 69..512 CDD:332142 65/318 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.