DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and acr-21

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001355512.1 Gene:acr-21 WormBaseID:WBGene00000060 Length:635 Species:Caenorhabditis elegans

Alignment Length:321 Identity:69/322 (21%)
Similarity:132/322 (41%) Gaps:43/322 (13%)


  Fly   179 NYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHF 243
            |.|| |....|..|.:.|..:| |.:|:.|.|                  ::..|.|   ::|.|
 Worm    21 NELS-SRADQNVMRLYRDLLYD-YNNEVRPSV------------------HSKEPIN---VTFVF 62

  Fly   244 Q-TRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSM 307
            . |:.:..::.:.:|.|...:.:||.|.:|||.|..:.::.....|..:||||.:.:.|.|....
 Worm    63 SLTQIIDVDERNQILTTNSWIRLHWVDYKLVWDPRLYQNVTRIHIPSDKIWKPDIILYNNADAQY 127

  Fly   308 GQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDD 372
            .:.:.|.:::|...|:|. :..:....|.|....:::|.:|.||.::......:|.:...|:..:
 Worm   128 MKSVMSTDVIVDYLGNIH-WPLSAIFTSSCPLDVKHYPFDRQTCILKYASWAYDGTKIDLLLKSE 191

  Fly   373 QRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVF 437
            |..  ..|...||.  ||       |:...:::.........:....:.:..|::|...||:...
 Worm   192 QGD--LTNYITNTE--WS-------LIGIRAEKNQVIYSCCPEPYPFIDVHVTIERRAMFYVFNL 245

  Fly   438 YLPLIACQMFLILSFVL--RSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVI 496
            .||.:...:..::.|.:  .|..:.:|.:.:||.....||.:.     ..:||...|..:|
 Worm   246 ILPCVLISLIALMGFYMPTDSGEKVTLGITSLLSTTVFLMMVA-----EGMPPTAEALPLI 301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 5/12 (42%)
Neur_chan_LBD 212..429 CDD:280998 42/218 (19%)
acr-21NP_001355512.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.