DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-31

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001256671.1 Gene:lgc-31 WormBaseID:WBGene00008997 Length:675 Species:Caenorhabditis elegans

Alignment Length:354 Identity:67/355 (19%)
Similarity:125/355 (35%) Gaps:86/355 (24%)


  Fly   217 EKLLSHLNIQAENASMPANLSSIS---FHFQTRSL-AYEQTSSLLQTRMHMMMHWRDSRLVWKPE 277
            :.||.:........:.|..:.|:|   |.:|...| |.:.|.||..:   ..::|.|..|.|.|.
 Worm   133 DDLLRYYRKGTRPVTHPKKVISVSMSVFLYQIVKLDAVKNTISLSGS---FELYWEDEFLKWNPS 194

  Fly   278 DFGSLESFEHPDLRIWKPHMNV-----LNGA--LQSMGQVLQSYELMVYANGSITLYAQNLQLAS 335
            .:...|........||.|..::     .|.|  |||...|..:|      .|.:..|.. ....|
 Worm   195 SYEGAEEIFLSSSDIWIPEFSLYYSLNFNDAVKLQSNNDVRVNY------TGQVRYYIP-FSSES 252

  Fly   336 WCVDSARNWPSERVTCDIELGLNGQEG--------QENVALI--YDDQRKPIAPN---------- 380
            .|....:.:|.:...|.:..|......        .:|::||  ||:|...:..:          
 Worm   253 LCKLDVKFFPFDVQQCSLLFGSWAHSNDSIKYSLYSQNLSLIDFYDNQEWELDTHNSSVHSDGFL 317

  Fly   381 -EHVNTPSGWSFTQMSVVL---------------------------VENDSQRRYNPK---GMMQ 414
             ::::.|..|....:::|:                           ..:.|.|..:.|   |:|.
 Worm   318 YDYLDPPLFWEMIIITLVMKRQSFYYVFNLVIPSTMITLVSVIGFHTPSTSGRMRDAKFRLGIMT 382

  Fly   415 KMTGDVAI--------EFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILI------ 465
            .|:..|.:        :|::..||....:...:|||....|::|:.:..||..:|:.:.      
 Worm   383 LMSMSVILLAIVEDMPKFSMGTNRRGRGSFSGIPLIGLYYFILLAIIGMSTVTTSMFVYLERESR 447

  Fly   466 ALLIAAWGLMYMTRYASPHYVPPMMTAYK 494
            ..:...|.|.:::...||..:...::.|:
 Worm   448 VKMNVPWYLKWLSFDISPSKIARKLSRYR 476

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 52/282 (18%)
lgc-31NP_001256671.1 Neur_chan_LBD 129..339 CDD:280998 44/216 (20%)
Neur_chan_memb 347..634 CDD:280999 23/131 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.