DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-6

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_501410.3 Gene:lgc-6 WormBaseID:WBGene00017544 Length:425 Species:Caenorhabditis elegans

Alignment Length:403 Identity:84/404 (21%)
Similarity:151/404 (37%) Gaps:77/404 (19%)


  Fly   212 EETKTEKLLSHLNIQAENASM-PA-NLSSISFHFQT-RSLAYEQTSSLLQTRMHMMMHWRDSRLV 273
            |.:.||.||..|..|..:..| |: :|:.::....| ..|:.:||...:|.....::.|.|..|.
 Worm    15 ETSNTETLLQQLFNQTYDVDMKPSDDLTMVTITPNTFILLSMDQTQETIQYSEEFLLRWYDPILH 79

  Fly   274 WKPEDFGSLESFEHPDLRI-----WKPHMNVLNGALQSMGQVLQSYELM--VYANGSITLYAQNL 331
            |..    |..|:|:..::|     |.|.:...||.  .|..:|.....|  :..||.|.. ::..
 Worm    80 WNQ----SAVSYENDWIKISASRAWIPDVIFTNGI--DMDPLLDKDMQMADLRYNGEIRT-SRPA 137

  Fly   332 QLASWCVDSARNWPSERVTCDIELG--------LNGQEGQENVALIYDDQRKPIAPNEHVNTPSG 388
            .::|.|.....|:|.:...|:|.:|        |:.|.....:.    .|:.....|      |.
 Worm   138 VVSSPCPLEIDNFPYDVQKCNISMGSWAFDRRFLSVQSSTIEIL----PQKGRFEGN------SE 192

  Fly   389 WSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLP-LIACQMFLILSF 452
            |..  :|::.|.:||   |:.  ::::...::....||:|...:|:.|...| .|.|.:.:...|
 Worm   193 WEL--ISILTVRSDS---YDT--LLEEWFSEITYVVTLKRKPVYYVLVIQAPTFILCTITIFGLF 250

  Fly   453 VLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVP-----PMMTAYKVI-MMTTTYCYILHICI- 510
            ...|.....|..:.|.:..:..:.|........:|     |::..|.:. :...|...|..|.| 
 Worm   251 TPNSNEDERLSKVELCLNMFAAISMMLQLVSDMMPKASRLPLLGNYIIAEIFVVTAATIASIIIQ 315

  Fly   511 -----IWLDLYPPRSKAPGWLVRVINSNVLRCIL-----GLRFS----DSTDYCDIQENPWHHMA 561
                 :......||.    |         |||::     ..|||    .:....|:.|:.....:
 Worm   316 QTHHHVHTSAIRPRR----W---------LRCLVLCECRRRRFSISEASTVSSVDVPEHAIQSFS 367

  Fly   562 KILNNLSSILVII 574
            .:.::|....|::
 Worm   368 ILKSSLHQTAVLV 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 54/235 (23%)
lgc-6NP_501410.3 LIC 1..424 CDD:273305 84/404 (21%)
Neur_chan_LBD 20..227 CDD:280998 52/231 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.