DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-5

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_501411.4 Gene:lgc-5 WormBaseID:WBGene00017543 Length:433 Species:Caenorhabditis elegans

Alignment Length:474 Identity:94/475 (20%)
Similarity:162/475 (34%) Gaps:124/475 (26%)


  Fly   177 VINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHL-------NIQAENASMPA 234
            ::.:|...:|||||                   ...|:.||.||..|       |::..:.....
 Worm     8 LLTFLVLRTFGSNT-------------------TNVESNTEVLLQELFNRTYDVNVKPSDTLTTV 53

  Fly   235 NLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFG-SLESFEHPDLRIWKPHMN 298
            .::..:|..    |:.:||...:......::.|.|..|.|....|. :.|..:....|:|.|  :
 Worm    54 TITPNTFLL----LSMDQTQETILFSQEFLLKWYDPILHWNRTLFDYNREWIKISVSRVWVP--D 112

  Fly   299 VLNGALQSMGQVLQSYELMVYA----NGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNG 359
            |:.....|:..:|.  |.|..|    ||.|......: :::.|..:.:::|.:...|:|.:|...
 Worm   113 VIFTKRLSVESLLD--EDMQMADLRYNGEIRTSLPAV-VSTSCPLNIQDFPHDVQECNISMGSWA 174

  Fly   360 QEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEF 424
            .:....|.....|:..|:......|  |.|..  :|:.....|| ..|:......::|..|    
 Worm   175 FDRTVIVVQSSVDEILPLRGRFEGN--SEWEL--LSIRAFRTDS-FEYSLGTSFSEITYTV---- 230

  Fly   425 TLQRNRSFYMTVFYLP-LIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVP- 487
            ||||...:|:.|...| .|.|.:.:...|...|.....|..:.|.:..:..:.|........:| 
 Worm   231 TLQRKPVYYVLVIQAPTFILCTITIFGLFSPNSNENERLSRVELCLNMFAAISMMLQLVSDMMPK 295

  Fly   488 ----PMMTAY------KVIMMTTTYCYILHI----------------CIIWLDL----YPPRSK- 521
                |::..|      .|...|.....|.|:                |::..|.    :|.::. 
 Worm   296 ASRLPLLGNYIIAEIFVVTAATIAAIVIQHVHHHVHTNATCPPKWLRCLVLCDCMREEFPSKTSS 360

  Fly   522 -----------AP-----------GWLVR-------VINSNVLRCILGLRFSDSTDYCDIQENPW 557
                       ||           .:|||       .||.|.|   |.|:..|.||.        
 Worm   361 VSSMDVPENIIAPVSLLKSSLHKTAFLVRDTLQEMSRINENQL---LWLKILDKTDL-------- 414

  Fly   558 HHMAKILNNLSSILVIITF 576
              |..||..::::::.|.:
 Worm   415 --MCLILFQVANVVITIVY 431

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 6/14 (43%)
Neur_chan_LBD 212..429 CDD:280998 50/229 (22%)
lgc-5NP_501411.4 Neur_chan_LBD 31..236 CDD:280998 47/223 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.