DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-22

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001255259.1 Gene:lgc-22 WormBaseID:WBGene00017483 Length:445 Species:Caenorhabditis elegans

Alignment Length:421 Identity:78/422 (18%)
Similarity:153/422 (36%) Gaps:101/422 (24%)


  Fly   218 KLLSHLNIQAENA----SMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPED 278
            ||.:|:....:||    :....:.|:    :..::..::....::.....::.|.|:.:.|..|.
 Worm    66 KLRTHIQTTYQNATDNKTKVVRVESV----RINNVEIDERRQNVKVFGRFVLSWNDTMVSWDKEQ 126

  Fly   279 FGSLESFEHPDLRIWKPHMNVLN-GALQSMGQVLQSY-------ELMVYANGSITL--------Y 327
            :| |.......::||.|::..:| |:..:.|||....       ::.::::.|.|.        |
 Worm   127 WG-LSWLNFYWIQIWTPNIVQINGGSTSNPGQVTSKVLAANYTGQIYLWSDFSFTTPFRFQYEDY 190

  Fly   328 AQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTP--SGWS 390
            ..::|...:..|..|.         :.:.....||.:|            ...|....|  |||.
 Worm   191 PNDMQRVCYKFDDKRL---------MAVHFTVAEGVKN------------KEREATTDPFVSGWK 234

  Fly   391 FTQMSVV--------------------LVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMT 435
            ...:.||                    .||..|..|.||.. :|...|::.|  :|:||..::..
 Worm   235 IEDVEVVSITHSPDNGGTGKNGLESPYTVEQLSDPRRNPFD-VQADNGELCI--SLRRNAVYFTA 296

  Fly   436 VFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTT 500
            ...||.:...:|.:.:...:.::...::|...::|....:.:.....|.:.....|..|......
 Worm   297 EMLLPALITSLFTLAAVFFQLSKTQPILLGFSVVAQILSLILVSQRLPSFTAHTPTILKYAGFNM 361

  Fly   501 TYCYILHICIIWL--------DLYPPR--SKAPGWLVRVI----NSNVLRCILGLRFSDST-DYC 550
            |:..||.:..:.|        |:.||.  |...|.:.:.:    ||         :..||| .|.
 Worm   362 TWTAILFVISLVLERMATSQVDIPPPHGVSTFAGLVNKFLPIPKNS---------KHEDSTLQYA 417

  Fly   551 DIQENPWHHMAKILNNLSSIL--VIITFAIV 579
            ...    |.:..::..||::|  ::|.|:.|
 Worm   418 AFA----HALNHVIFALSTVLYFIVILFSFV 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 47/253 (19%)
lgc-22NP_001255259.1 ShKT 24..58 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.