DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and acc-2

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_501567.1 Gene:acc-2 WormBaseID:WBGene00008280 Length:445 Species:Caenorhabditis elegans

Alignment Length:342 Identity:74/343 (22%)
Similarity:134/343 (39%) Gaps:71/343 (21%)


  Fly   280 GSLESFEHPDL-RIWKPHMNVLNGAL-QSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSAR 342
            |:| |..|..| |:|.|:...:|..: |......:|..||::.||:: :....:::...|.....
 Worm   120 GNL-SLNHQVLDRLWTPNSCFINSKVAQIHNSPFRSVFLMLFPNGTV-MVNYRVRVKGPCSLDLS 182

  Fly   343 NWPSERVTCDI---ELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQ 404
            |:|.:...|.:   ....|.||    |.:.:.|...|:.....:..|        ...|.|..::
 Worm   183 NFPLDLQKCSLIYESFNYNRQE----VEMRWSDAEHPVFNLSKIMLP--------DFDLFEIQTE 235

  Fly   405 RRYN--PKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRS---TRRSSL-- 462
            ||..  |.||..::  .|.|.|  :|...:|....|||.........:||.|.|   ..|:.|  
 Worm   236 RRQEPYPAGMWDEL--HVTIIF--ERRFIWYFMQAYLPTYLTIFISWISFSLGSRAIPARTMLGV 296

  Fly   463 -ILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLDLYPPRSKAPGWL 526
             .|:|::.:...:|......|  |:.. :..:.::.||..:|.:|.:.|:            |::
 Worm   297 NSLLAIVFSFGNIMRNLPRVS--YIKG-IDVWMLVSMTFIFCSLLELAIV------------GFM 346

  Fly   527 VR-----------VINSNVLR------CILGLRF------SDSTDYCDIQENPWHHMAKILNNLS 568
            ||           .|:.|:.|      .|...||      |:|:.......:.|  ..:.::::|
 Worm   347 VRDETVAKKKQQKKISGNISREESPHGIISERRFMFPPGCSESSKSLSSCTSGW--TPERIDSIS 409

  Fly   569 SILVIITFAIVDITSGF 585
            |::...:|.:.:|...|
 Worm   410 SVMFPFSFFVFNIIYWF 426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 37/156 (24%)
acc-2NP_501567.1 Neur_chan_LBD 51..258 CDD:308532 37/156 (24%)
Neur_chan_memb 267..>347 CDD:308533 20/95 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.