DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-48

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_506308.3 Gene:lgc-48 WormBaseID:WBGene00008223 Length:366 Species:Caenorhabditis elegans

Alignment Length:368 Identity:71/369 (19%)
Similarity:128/369 (35%) Gaps:100/369 (27%)


  Fly   203 GSEI----APIVKEETKTEKLL-----SHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQ 258
            |.|:    :..:.|....||||     |...|..||..    ..|:.|..|..:...|.|:. .:
 Worm    15 GEEVHELRSECLNEAQLMEKLLKGSGYSKHKIPRENGI----TVSVEFWIQEINSISEMTND-FE 74

  Fly   259 TRMHMMMHWRDSRLVWKPEDFGSLESFEHPDL---------------RIWKPHMNVLNGALQSMG 308
            ..:.:...|.|             .|...|.|               ::|.|:...:|      .
 Worm    75 LELFINEMWTD-------------PSLRFPHLGACKANLTLDQQTLTKLWTPNTCFVN------S 120

  Fly   309 QVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERV----TCDIEL----------GLNG 359
            :..:.|| ..:.|..:||:           |:...|.:.||    .|:::|          .||.
 Worm   121 KFAEIYE-SSFQNVFLTLF-----------DNGTVWVNYRVRVKGACNMDLVDFPMDTQSCRLNY 173

  Fly   360 QE---GQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVA 421
            |.   ..|.|.|.::.||.|:...:.:.....| ...::..:::.|     .|.|:..    ::.
 Worm   174 QSFTYNNEEVRLQWNSQRSPVFALQEIRIADFW-LKDITPAVIKRD-----YPAGLWD----ELV 228

  Fly   422 IEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRS------TRRSSLILIALL--IAAWGLMYMT 478
            :.|..:|...:|....|||..   ..:.:|::..|      |.|:.:.:.|||  |..:|.: |.
 Worm   229 VTFVFERRYMWYFLQAYLPTF---FSIFISWIAFSLGPQAITPRTMIGVNALLSMIFHFGSI-MK 289

  Fly   479 RYASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLDLYPPRSK 521
            ......|: ..:..:.:..||..:..::.:.|:...|...|.|
 Worm   290 NLPRVSYI-KAIDVWMLSSMTFVFLSLIELAIVGYKLQIQREK 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 48/254 (19%)
lgc-48NP_506308.3 Neur_chan_LBD 28..237 CDD:280998 48/255 (19%)
Neur_chan_memb 245..>323 CDD:280999 17/83 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.