DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-41

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001123116.1 Gene:lgc-41 WormBaseID:WBGene00008022 Length:564 Species:Caenorhabditis elegans

Alignment Length:346 Identity:71/347 (20%)
Similarity:135/347 (39%) Gaps:61/347 (18%)


  Fly   219 LLSHLNIQ--AENASMPAN------LSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWK 275
            ||...|.:  ..|||:|..      |.|:. :|::..::::       ..:::.|.|:|.||.  
 Worm    34 LLQQSNTRPPTANASVPLGVKLGMYLESLG-NFRSSEMSFD-------VDLYVYMSWQDPRLA-- 88

  Fly   276 PEDFGSLESFEHPDLR--IWKPHMNVLNGALQSMGQV-LQSYELMVYANGSITLYAQNLQLASWC 337
             .:|.......:.::|  ||.|.:...|....|..:| :.::.|.|..:|::. |:....|...|
 Worm    89 -HNFSDYVLINNDEIRKQIWLPDLYFANARQASFQEVTVPNFNLFVAPDGTVA-YSCRCTLTVAC 151

  Fly   338 VDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTP--------SGWSFTQM 394
            ..:.|.:|.::..|.|.: |:.....:.|.:.:.| :.|:..||.:..|        :.:.....
 Worm   152 SLNLRYYPMDQQLCSIRV-LSYAYIAKQVNVTWFD-KNPVRFNEEIGLPEFQIEHVSNAYCNGSY 214

  Fly   395 SVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRR 459
            ...|.||..:     ......::|::    .|.|:..:.:...|:|.....|...:||.:  .||
 Worm   215 QYALTENSYK-----SDDFSCLSGNL----FLSRSIGYNLVQSYIPTGLIVMISWVSFWI--DRR 268

  Fly   460 --------SSLILIALLIAAWGLMYMTRYASPH--YVPPMMTAYKVIMMTTTYCYILHICIIWLD 514
                    |...|::|.....||    |:..|.  |...:...|...|. ..:|.:|....|  :
 Worm   269 AVPARVTLSFTTLVSLTTLGNGL----RFGLPQVSYAKAIDLWYGACMF-FVFCALLEFATI--N 326

  Fly   515 LYPPRSKAPGWLVRVINSNVL 535
            .|..:|:....:.:.:.|.||
 Worm   327 SYMRKSEKFDSMAKKMQSVVL 347

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 46/229 (20%)
lgc-41NP_001123116.1 Neur_chan_LBD 43..202 CDD:280998 37/173 (21%)
Neur_chan_memb 249..551 CDD:280999 25/109 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.