DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and glc-4

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_495489.2 Gene:glc-4 WormBaseID:WBGene00001594 Length:500 Species:Caenorhabditis elegans

Alignment Length:354 Identity:75/355 (21%)
Similarity:125/355 (35%) Gaps:63/355 (18%)


  Fly   245 TRSLAYEQTSSLLQTRMHMM------MHWRDSRLVWKPEDFGSLES------FEH--PDLRIWKP 295
            |.||.....|::.:..|..:      ..|.|.||.: .|..|.|.|      |.|  .|..:|.|
 Worm    77 TTSLNIRSISAVSEKNMEFVAQFRFRQEWYDDRLRF-IEHQGLLSSDYRNFEFIHVARDQSLWIP 140

  Fly   296 ---HMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGL 357
               ..|..||....:.|  ::..|.:.::|.: :|.:.|.|...|......:|.:...|:|....
 Worm   141 DTFFQNEKNGWYHMLNQ--ENRFLKIRSDGKL-IYDRRLTLHLACSMHLSRYPMDHQNCEIAFAS 202

  Fly   358 NGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAI 422
            .... ..::..|:|      .|...::..:..:.....:...:|.|.......|....:    .:
 Worm   203 YAYT-TADIEYIWD------VPAIQIHEGANGALPNFEIASFKNASCTSKTNTGTYSCL----KV 256

  Fly   423 EFTLQRNRSFYMTVFYLPLIACQMFLILSFV-----LRST-RRSSLILIALLIAAWGLMYMTRYA 481
            |..|.|..||::...|:|   ..|.:.:::|     .:|| .|..|.::.||     .|..|.:|
 Worm   257 EIRLNRVFSFFLLQLYIP---SSMLVGVAWVSYWIDWKSTAARVPLAIVTLL-----TMITTSHA 313

  Fly   482 SPHYVPPMMTAYK-----------VIMMTTTYCYILHICIIWLDLYPPRSKAP---GWLVRVI-N 531
            ....:||:..|..           :......|..:.::.|  ||.:....||.   ..|..|| |
 Worm   314 INSNLPPVSYAKSIDIWVGACVVFIFFSLIEYAVVNYVGI--LDEHRQMKKAACNRSRLSNVIEN 376

  Fly   532 SNVLRCILGLRFSDSTDYCDIQENPWHHM 560
            .|....:..|.||.......|:..|..:|
 Worm   377 DNFGESLQSLTFSPQEKKRLIRRRPKKNM 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 40/201 (20%)
glc-4NP_495489.2 LIC 26..491 CDD:273305 75/355 (21%)
Neur_chan_LBD 50..258 CDD:280998 38/196 (19%)
Neur_chan_memb 271..488 CDD:280999 33/146 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.