DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-23

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_510016.2 Gene:lgc-23 WormBaseID:WBGene00007594 Length:403 Species:Caenorhabditis elegans

Alignment Length:359 Identity:64/360 (18%)
Similarity:128/360 (36%) Gaps:74/360 (21%)


  Fly   211 KEETKTEKLLSHLNIQAE-----NASMPANL-----SSISFHFQTRSLAYEQTSSLLQTRMHMMM 265
            :|..:.:..|.|..::.:     :.|||:.|     :.:.....:|   .::.:..|...:.:..
 Worm    23 EESERHQAYLDHRKLKEDVLGPLDGSMPSELPVFIGAQLKLDHISR---VDEKTGFLTLALTVKF 84

  Fly   266 HWRDSRLVWKPEDFGS-----LESFEHPDLRIWKPHMNVLNGALQSMGQVLQ-----SYELMVYA 320
            .|.|.||.|.|..:..     ||..:....:||||.:.:.|...:...:.:.     ..|:.:::
 Worm    85 MWSDERLQWDPSHYSGFTRTRLEFVDFWLYQIWKPRIYMTNTYERRQSKTIDLLSNTLVEMDIHS 149

  Fly   321 NGSITLYAQNLQLASWCVDSARNWPSERVTC-----------DIELGLNGQEGQ--------ENV 366
            .|.: :....:.|.::|....:.:|.:...|           ||.||.:..:.:        :.|
 Worm   150 KGFV-MTTTKILLKTFCFLDFKGYPHDFQNCSFSFIPNMNANDIFLGSSMLKAKFTKDFTDPQQV 213

  Fly   367 ALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRS 431
            ..:.|.|...:.      |...:.|...   :|.:|..|  .|:.:::..   |:....|||...
 Worm   214 VRVQDFQINDVV------TEDLYLFMNR---IVLHDLTR--EPRSLVRSF---VSFTIVLQRKNV 264

  Fly   432 FYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVI 496
            :.....|.|:|.....||:|..|.|.....|::..|:..     |:..:.....:|........|
 Worm   265 YVHLQLYAPMIFICTCLIISGFLPSEYALPLLVFNLISE-----YLYFHNIKDVLPTDFDGTPTI 324

  Fly   497 MMTTTYCYILHICIIWLDLYPPRSKAPGWLVRVI 530
            .:..|:.....:.||            ||.:.:|
 Worm   325 ALIATFTLAETMSII------------GWKMFII 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 45/256 (18%)
lgc-23NP_510016.2 Neur_chan_LBD 34..262 CDD:280998 43/246 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.