DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-9

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_500341.1 Gene:lgc-9 WormBaseID:WBGene00015412 Length:464 Species:Caenorhabditis elegans

Alignment Length:378 Identity:70/379 (18%)
Similarity:133/379 (35%) Gaps:95/379 (25%)


  Fly   267 WRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQS-YELMVYANGSITLYAQN 330
            |||.:|.|.|.|...|.....|...:|.|.:.:.| ::.:...:... |::.:...|.:.:.:..
 Worm    97 WRDPKLAWNPADHSGLTQVVMPRSLVWVPKLFIYN-SMDTKDMLTDDRYDVRIQHTGHVKVNSPQ 160

  Fly   331 LQLASWCVDSARNWPSERVTCDIELG---LNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFT 392
            . :::.|..:...:|.:...|.|.|.   |:.:|...|..      :.|:  :.:.:..:.|...
 Worm   161 F-VSTLCRINIDLFPFDTQFCAIALASPLLSVEEMDVNAT------QPPV--DSYFSGNAEWQVM 216

  Fly   393 QMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRST 457
            .::|      .|.::..:|   :...:|.....|.|..::|:||..:|........||......:
 Worm   217 NVTV------KQMKFMEEG---EYRAEVHYILHLNRRPTYYITVIVVPTFLISALSILGIFSPGS 272

  Fly   458 R---RSSLILIAL--LIAAWGLMYMTRYASPHY-VPPMMTAYKVIMMTTTYCYI----------- 505
            .   |:..:.:.|  |:|...|:.:...|.|.. ..|::..|  ||:....|.|           
 Worm   273 NDGPRNEKVSLGLGSLLAMTVLLDIVAGAMPKSDAIPLLGYY--IMLVILLCAIGVAVSMAMLSM 335

  Fly   506 LHICIIWLDLYPPRSKAPGWLVRVINSNVLRCI---LGL--------------RFSD-------- 545
            ...||....:.||.      ..|::..||.|.:   .||              ||.|        
 Worm   336 SRSCIQTSKMPPPH------YYRLLFLNVCRVVKQNSGLNGVAMNEKPTAITPRFPDLIAIYNQL 394

  Fly   546 ------STDYCD-IQENPWHHMAKI---------------LNNLSSILVIITF 576
                  ...|.: |::..|.|..:|               |..:.::|:::.|
 Worm   395 IEVARAQRTYRERIEKQKWQHRVEIEWNKIFARIDFFFLFLFEMFNVLILVLF 447

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 30/166 (18%)
lgc-9NP_500341.1 Neur_chan_LBD 42..245 CDD:280998 30/167 (18%)
Neur_chan_memb 252..>347 CDD:280999 18/97 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.