DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-25

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_510359.3 Gene:lgc-25 WormBaseID:WBGene00010994 Length:502 Species:Caenorhabditis elegans

Alignment Length:383 Identity:68/384 (18%)
Similarity:142/384 (37%) Gaps:104/384 (27%)


  Fly   193 WFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAY-EQTSSL 256
            |..|       :::..:.||:...::|:...|.:.......|.::.::...   |:|: |:....
 Worm    15 WHLD-------NQVCGLSKEQQLEKQLMVKYNYKVRPVKSEATVTQVNVFL---SIAHVEKVDEH 69

  Fly   257 LQTRM---HMMMHWRDSRLVW--KPEDFGSLESFEHPDLRIWKPHMNVLNGA------------- 303
            .||.:   |:...|.|..:.|  |.|:...|....|   .:|:|.:.:.|.|             
 Worm    70 EQTALVHGHIWATWIDEYMQWDAKKENVTKLTISAH---SLWQPALALYNSARGNSWHLYMGAMP 131

  Fly   304 --LQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIEL-----GLN--- 358
              :.|.|:        |::.|:.:.|..       |.....|||.::.:|.|.:     .||   
 Worm   132 ATVYSTGK--------VWSTGTFSFYVT-------CQFDFTNWPFDQQSCPIVIADWVYNLNQVN 181

  Fly   359 -------GQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRR---YNPKGMM 413
                   .:.|:.::.|.||...|  :...||   :||...         |:.::   :.|||..
 Worm   182 LSDPYILKEYGKPSIRLSYDPIEK--SDKRHV---AGWEVM---------DAWKKHCYWGPKGCK 232

  Fly   414 QKMTGDVA------IEF--TLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIA 470
            ::.....|      :||  .|:|:..::......|:....:.|:|.|.:.:   .|:....::: 
 Worm   233 EEQPEGEAEWYWSLLEFGIILRRHLPYFSLSILFPMAGTSLILLLCFWIET---HSICFFTIML- 293

  Fly   471 AWGLMYMTRYAS---------PHYVPPMMTAYKVIMMTTTYCYILHICIIWLDLYPPR 519
              .::..:.|.|         ....|.::..|.:.::.:...::|.:...:|.|..|:
 Worm   294 --NIILQSYYGSSLLAKMPPGSGRTPKIVHLYNMNLLLSAVQFVLIVFSEFLRLRLPK 349

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 52/264 (20%)
lgc-25NP_510359.3 Neur_chan_LBD 27..256 CDD:280998 52/264 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.