DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-21

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_510341.2 Gene:lgc-21 WormBaseID:WBGene00007903 Length:462 Species:Caenorhabditis elegans

Alignment Length:405 Identity:79/406 (19%)
Similarity:153/406 (38%) Gaps:79/406 (19%)


  Fly   215 KTEKLLSHLNIQAENASMPANLSS---ISFHFQTRSLA-YEQTSSLLQTRMH--MMMHWRDSRLV 273
            ::.|.|:.|||....||:|.|..|   ::.:|...:|. :|....|....:|  :.:.|.|.||:
 Worm    86 ESAKKLAKLNIPHAIASIPPNYLSQQPVTINFAQFTLQHFELNEHLKDISIHGYLELSWHDDRLM 150

  Fly   274 WKPEDFGS----LESFEHPDLRIWKPHMNVLN--GALQSMGQVLQSYELMVYANGSITLYAQNLQ 332
            |..:.:..    :.||.|    ||.|.:...|  ..|:: |...:..::.....|:::.... ..
 Worm   151 WNQDTWKKNKLVVHSFHH----IWVPLLGSQNPENHLKN-GDAFEIRKVETTNQGNVSAKVA-FS 209

  Fly   333 LASWCVDS-ARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSV 396
            |.::|.|: ..|:|::...|....    :..|:...:.:.....||..:.......||.   :|.
 Worm   210 LRTFCDDTDFENYPNDVYKCCFSF----EPQQDREVIQFTSSGLPIFTDPKNFRDYGWG---VSG 267

  Fly   397 VLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSS 461
            .:.|:..    :|..:.|     :.....|:|..|.......:||.......:|..:..|.:   
 Worm   268 TVPESFD----DPSEIAQ-----LGFCLNLKRAHSSLKIELAIPLFITTALFLLPPLFGSVK--- 320

  Fly   462 LILIALLIAAWGLMYMTRYASPHYVPPMMTA----------------YKVIMMTTTYCYILHICI 510
             |.|.|.:...||.:||.......:.|.:::                :.:|.:||:  .|:..|:
 Worm   321 -IQIYLKMFVMGLQFMTLLIFSTRIAPFLSSTASTPKPMRFLEIALVFNLISITTS--IIIFCCM 382

  Fly   511 IWLDLYPPRSKAPGWLVRVINSNVLRCILG-LRFSDSTDY----CDIQ------ENPWHHM---- 560
            ......||..:...:      :|.:...|| |..|...:|    .|.|      :..|.::    
 Worm   383 QVKRTLPPWGRVTQF------ANFINGFLGVLNISGVEEYNLDKYDEQVSQNSYQKDWANVFRAA 441

  Fly   561 -AKILNNLSSILVII 574
             |.::..:|:|::.:
 Worm   442 HAVLMGTISAIVIFV 456

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 47/227 (21%)
lgc-21NP_510341.2 Neur_chan_LBD 103..261 CDD:280998 32/168 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.