DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and acr-12

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_510262.1 Gene:acr-12 WormBaseID:WBGene00000051 Length:573 Species:Caenorhabditis elegans

Alignment Length:352 Identity:75/353 (21%)
Similarity:142/353 (40%) Gaps:72/353 (20%)


  Fly   246 RSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGA-----LQ 305
            |.:..::.:.:|.|.:.:.|.|.|::|.|.||.:|.|::...|...||.|.:.:.|.|     :.
 Worm    73 RIIDVDEKNQVLTTNLWLEMKWNDAKLTWTPEKYGGLKTLHIPSDFIWTPDLVLYNNAAGDPDIT 137

  Fly   306 SMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIY 370
            .:...|.::|..||.... .:|      .|:|......:|.:...|:::.|.....|:      |
 Worm   138 ILTDALVTFEGNVYWQPP-AIY------KSFCPIDVTWFPYDSQKCEMKFGTWTYTGR------Y 189

  Fly   371 DDQRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAI-----EFTLQRNR 430
            .|.::  .|.|.|            |.:.::|:...:..:||      |::.     |:.|....
 Worm   190 VDLKQ--LPQEEV------------VTITKDDNDVEFMQQGM------DLSFFYRSAEWDLLSLT 234

  Fly   431 SFYMTVFYLPLIACQMFLILSFVLRSTRRS-----SLILIALLIAAWGLMYMTRYASPHYVPPMM 490
            |...:|.|......:.::.:::.....|::     :|||...||:.  |.....|.|.|.:    
 Worm   235 SERHSVLYASCCGPEKYVDITYYFGLRRKTLFFTCNLILPCFLISI--LTTFVFYLSDHKI---- 293

  Fly   491 TAYKVIMMTTTYCYILHICIIWLDLYPPRSKA-PGW-------LVRVINSNVLRCI-LGLRFSDS 546
             .:.:.::.|...:.|    :.:||.||.|.. |.:       ::.|..|.|:..| :..||...
 Worm   294 -TFSISILVTLTVFFL----VLIDLMPPTSLVIPMFGRYLITTMILVALSTVVSVITVNFRFRSG 353

  Fly   547 TDYCDIQENPWHHMAKILNNLSSILVI 573
            :.:   :.:||.. |..|..|..||::
 Worm   354 SAH---KMSPWIR-AVFLKFLPKILLM 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 41/193 (21%)
acr-12NP_510262.1 LIC 14..539 CDD:273305 75/353 (21%)
Neur_chan_LBD 38..264 CDD:280998 45/224 (20%)
Neur_chan_memb 271..538 CDD:280999 30/122 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.