DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and acr-8

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_509745.2 Gene:acr-8 WormBaseID:WBGene00000047 Length:537 Species:Caenorhabditis elegans

Alignment Length:396 Identity:82/397 (21%)
Similarity:150/397 (38%) Gaps:120/397 (30%)


  Fly   217 EKLLSHLNIQA---ENASMPANLSSISFHFQT---RSLAYEQTSSLLQTRMHMMMHWRDSRLVWK 275
            |.||.:.|...   :|||     .|:...|.:   |.:..::.:.:|.|.:.:.|.|.|.||:|.
 Worm    30 EDLLYYYNKNVRPIKNAS-----ESVKVKFGSSLIRIIDVDEVNQVLTTNLWLEMQWFDYRLMWD 89

  Fly   276 PEDFGSLESFEHPDLRIW------------KPHMNVLNGALQSMGQVLQSYELMVYANGSITLYA 328
            |..:|.:.....|..:||            :||:.:::.|:             ||.||.:....
 Worm    90 PGRWGKIRKLHVPVDQIWIPDILLYNNADGEPHITIMSDAI-------------VYYNGLVVWKP 141

  Fly   329 QNLQLASWCVDSARNWPSERVTCDIELG---LNG------QEGQENVALIYDDQRKPIAPNEHVN 384
            .:: ..|:|......:|.:..||.::.|   .||      |...|...|:...::..:.  .|.:
 Worm   142 PSI-YKSFCSIDIEYFPYDTQTCWMKFGGWTYNGFLLDVRQLPVEEWTLVVTTRKLQVC--AHAS 203

  Fly   385 TPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTG---------DVAIEFTLQRNRSFYMTVFYLP 440
            :.| :.|..:...|:|.:|.|.       :|:..         |:..:..::|...||.....:|
 Worm   204 SIS-FFFRSLEWDLMELNSARH-------EKIYAGCCGQDFYIDITFKIEIRRKTLFYTINLMIP 260

  Fly   441 LIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPM---MTAYKVIMMTTTY 502
               |.||.||:.::                             .||||:   ||....|::|.|.
 Worm   261 ---CTMFAILTSIV-----------------------------FYVPPIEHKMTFSISILVTLTV 293

  Fly   503 CYILHICIIWLDLYPPRS-------KAPGWLVRVINSNVLRCILGLRF--SDSTDYCDIQENPWH 558
            .|     :|.:||.||.|       |...:.:.:::.:::..::.|.|  .|.:.:      |..
 Worm   294 FY-----LILIDLVPPTSLVIPLIGKYLLFTMFLVSISIMLSVISLNFYRRDGSSF------PMP 347

  Fly   559 HMAKIL 564
            |..|::
 Worm   348 HWMKVV 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 51/248 (21%)
acr-8NP_509745.2 Neur_chan_LBD 25..250 CDD:280998 51/249 (20%)
LIC 26..475 CDD:273305 82/397 (21%)
Neur_chan_memb 257..473 CDD:280999 29/141 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.