DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-47

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_741878.1 Gene:lgc-47 WormBaseID:WBGene00009799 Length:428 Species:Caenorhabditis elegans

Alignment Length:307 Identity:67/308 (22%)
Similarity:115/308 (37%) Gaps:68/308 (22%)


  Fly   204 SEIAPIVK--------EETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTR 260
            :||:|.|.        .:|   :::.||.|..........|.|.....:......|.||....|:
 Worm    40 AEISPTVSYLLDRGCANDT---EIIDHLLIDRALYYNKHKLPSPQVDVRIEMWVQEVTSVSELTQ 101

  Fly   261 -----MHMMMHWRDSRLVWKPEDF-----GSLESFEHPDLR-IWKPHMNVLNG-ALQSMGQVLQS 313
                 ::|..:|.|..|.:   |.     |:| ||:...:: ||.|:...:|. ..|.......:
 Worm   102 DFEIDLYMNEYWTDPGLAY---DILNPCQGNL-SFDWAVMQNIWTPNTCFINSKKAQLHSSPFTN 162

  Fly   314 YELMVYANGSITLYAQNLQLASW--CVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKP 376
            ..|||:.|||:.   .|.::.|.  ||.....:|.:.:.|.:... :....::.|.:.:.|  .|
 Worm   163 VFLMVFPNGSVW---SNWRIKSTGPCVMDLTKFPMDSIECTLTFE-SFNYNKDEVFMRWGD--PP 221

  Fly   377 IAPNEHVNTPSGWSFTQMSVVLVENDSQ-------RRYNPKGMMQKMTGDVAIEFTLQRNRSFYM 434
            :...:.:..|   .|| |:.....|..|       ...|...:.::.:|    .:.||.....||
 Worm   222 LTIFKPIELP---DFT-MTNFSTSNKFQLYAAGYWSELNVNFLFRRRSG----WYLLQGYIPTYM 278

  Fly   435 TVF--YLP------------LIACQMFLILSF----VLRSTRRSSLI 463
            |||  ::|            :|.....|.|:|    ::|:..|.|.|
 Worm   279 TVFISWIPFYLGPKAIPARTMIGVNALLALTFQFGNIIRNLPRVSYI 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 49/238 (21%)
lgc-47NP_741878.1 Neur_chan_LBD 58..264 CDD:280998 46/223 (21%)
LIC 59..419 CDD:273305 62/286 (22%)
Neur_chan_memb 273..>352 CDD:280999 14/54 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.