DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and lgc-4

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_509556.4 Gene:lgc-4 WormBaseID:WBGene00017580 Length:635 Species:Caenorhabditis elegans

Alignment Length:559 Identity:108/560 (19%)
Similarity:190/560 (34%) Gaps:175/560 (31%)


  Fly    12 YCCL---CLLLILIDPAESGQL---STRFNVSFAQLDSCETYSVPNTGYGYRRFYMLRELSNNNR 70
            |.||   .||.|...|.....:   :|:..|.|:.|||                   |:.::.| 
 Worm     5 YSCLTVSILLTIKFVPCRFAGIEHQNTKSRVHFSLLDS-------------------RQENDTN- 49

  Fly    71 KAGERLHLKFYVLTAMDAHILLSVTNHPRPNDRVYEIVIGAGGNTFSAIRNAMGMRRVATNQEPN 135
                              |..::.....:|::.                .|.:|           
 Worm    50 ------------------HFEIAEAKFQKPHNE----------------ENTIG----------- 69

  Fly   136 LVSLYDPTPIEIVQNQNGELFVYIPGFKKEPLLQFIDEAPLVINYLSFSSFGSNTARWFYDCGFD 200
            .::.:.|:    ||.|:....:.:|.|.:..|     |..|.|.       ||          .|
 Worm    70 TITKFAPS----VQEQHSSAVIPMPHFDQNRL-----EQALRIK-------GS----------ID 108

  Fly   201 GYGSEIAPIVKEETKTEKLLSHLNIQAE-----NASMPANLSSISFHFQTRSLA-YEQTSSLLQT 259
            |         .||.....||.|...:.:     :.|.|.|   ::|.|....:. .::.:..|.|
 Worm   109 G---------TEEALYRSLLDHTVYEKDVRPCIHHSQPTN---VTFGFLLNQIVEMDERNQALTT 161

  Fly   260 RMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSI 324
            |..:.::|.|.||.|....:..:::...|..|||||.:.::|.|::.....|.|.::||.::|::
 Worm   162 RSWLNINWMDPRLSWNESLWSEIKAIYIPHARIWKPDIILVNNAIREYYASLVSTDVMVTSDGNV 226

  Fly   325 TLYAQNLQLASWCVDSARNWPSERVTCD------------IELGLNGQEGQENVALIYDDQRKPI 377
            |.....| ..|.|....|.:|.:...||            |.||||..:|.              
 Worm   227 TWLFSAL-FRSSCPIRVRYYPFDDQQCDLKFASWSHDITEINLGLNTDKGD-------------- 276

  Fly   378 APNEHVNTPSGWSFTQMS----VVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFY 438
             .:.::|. |.:....|:    ||...:|:...:          ..:.|...:.|...||:....
 Worm   277 -LSSYMNN-SEFDLVDMTAVREVVTFPSDTNSDW----------PIIVIRIHMHRRPLFYVFNHI 329

  Fly   439 LPLIACQMFLILSFVL--RSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMM--- 498
            :|.:......:|.|::  .:..:.::|:..||.....|..:|     ..:||......:|.|   
 Worm   330 VPCVLISSMAVLGFLMPPETGEKINMIITTLLSMGVYLQSIT-----ESIPPTSEGVPLIGMYYV 389

  Fly   499 TTTYCYILHICIIWLDLYPPRSKA-------PGWLVRVI 530
            ::.....|..|:..:.|...|:.|       |.|:.:.|
 Worm   390 SSLLMVCLATCVNVITLNMHRNGAANQGRHVPAWMQKWI 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 15/101 (15%)
Neur_chan_LBD 212..429 CDD:280998 53/239 (22%)
lgc-4NP_509556.4 Neur_chan_LBD 111..321 CDD:280998 53/240 (22%)
Neur_chan_memb 329..>457 CDD:280999 20/106 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.